Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inorganic pyrophosphatase (PPA1), partial

Product Specifications

Product Name Alternative

(Pyrophosphate phospho-hydrolase) (PPase)

Abbreviation

Recombinant Human PPA1 protein, partial

Gene Name

PPA1

UniProt

Q15181

Expression Region

228-289aa

Organism

Homo sapiens (Human)

Target Sequence

KALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

10.8 kDa

References & Citations

"Structural and biochemical characterization of inorganic pyrophosphatase from Homo sapiens." Hu F., Huang Z., Zheng S., Wu Q., Chen Y., Lin H., Huang W., Li L. Biochem Biophys Res Commun 533:1115-1121 (2020)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2-difluoro-3-phenylpropanoic acid
TRC-D455173-5MG 5 mg

2,2-difluoro-3-phenylpropanoic acid

Sign In for Pricing
View Details
Basic Green 4 (Technical Grade)
TRC-B127633-5G 5 g

Basic Green 4 (Technical Grade)

Sign In for Pricing
View Details
Myeloperoxidase Recombinant Mouse Monoclonal Antibody [A1F2-R]
HA601249 100 µL

Myeloperoxidase Recombinant Mouse Monoclonal Antibody [A1F2-R]

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS804550 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
Human Heat Shock 27kDa Protein 1 (HSPB1) ELISA Kit
RD-HSPB1-Hu-01 96 Tests

Human Heat Shock 27kDa Protein 1 (HSPB1) ELISA Kit

Sign In for Pricing
View Details
Human Heat Shock 27kDa Protein 1 (HSPB1) ELISA Kit
RD-HSPB1-Hu-02 48 Tests

Human Heat Shock 27kDa Protein 1 (HSPB1) ELISA Kit

Sign In for Pricing
View Details