Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPH1, Human (HEK293, His)

The NXPH1 protein resembles a neuropeptide and may affect cell signaling by binding to alpha-neurotoxins and other potential receptors. Although the specific mechanisms and downstream effects remain unclear, the neuropeptide-like characteristics of NXPH1 suggest that it plays a role in regulating cell signaling pathways. NXPH1 Protein, Human (HEK293, His) is the recombinant human-derived NXPH1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

NXPH1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nxph1-protein-human-hek-293-his.html

Purity

90.0

Smiles

ANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG

Molecular Formula

30010 (Gene_ID) P58417 (A22-G271) (Accession)

Molecular Weight

45-58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-RPS3 antibody
MBS7603710-01 0.1 mg

anti-RPS3 antibody

Sign In for Pricing
View Details
anti-RPS3 antibody
MBS7603710-02 5x 0.1 mg

anti-RPS3 antibody

Sign In for Pricing
View Details
Tnfrsf13c (NM_028075) Mouse Tagged ORF Clone
MR226524 10 µg

Tnfrsf13c (NM_028075) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Ethyl 3-amino-3- (3-bromophenyl) propanoate oxalate
OR1037675-01 1 g

Ethyl 3-amino-3- (3-bromophenyl) propanoate oxalate

Sign In for Pricing
View Details
Ethyl 3-amino-3- (3-bromophenyl) propanoate oxalate
OR1037675-02 5 g

Ethyl 3-amino-3- (3-bromophenyl) propanoate oxalate

Sign In for Pricing
View Details
CDX2 (NM_001265) Human Tagged ORF Clone
RC204883 10 µg

CDX2 (NM_001265) Human Tagged ORF Clone

Sign In for Pricing
View Details