Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPH1, Human (HEK293, His)

The NXPH1 protein resembles a neuropeptide and may affect cell signaling by binding to alpha-neurotoxins and other potential receptors. Although the specific mechanisms and downstream effects remain unclear, the neuropeptide-like characteristics of NXPH1 suggest that it plays a role in regulating cell signaling pathways. NXPH1 Protein, Human (HEK293, His) is the recombinant human-derived NXPH1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

NXPH1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nxph1-protein-human-hek-293-his.html

Purity

90.0

Smiles

ANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG

Molecular Formula

30010 (Gene_ID) P58417 (A22-G271) (Accession)

Molecular Weight

45-58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MESP1 Antibody / Mesoderm Posterior Protein 1
RQ5990 100 µg

MESP1 Antibody / Mesoderm Posterior Protein 1

Sign In for Pricing
View Details
Rabbit Monoclonal CD30/TNFRSF8 Antibody (Ki-1/1747R) [Alexa Fluor 532]
NBP2-54556AF532 0.1 mL

Rabbit Monoclonal CD30/TNFRSF8 Antibody (Ki-1/1747R) [Alexa Fluor 532]

Sign In for Pricing
View Details
Rat IFNα (Interferon Alpha) ELISA Kit
EKE63116 96 Tests

Rat IFNα (Interferon Alpha) ELISA Kit

Sign In for Pricing
View Details
MAN2A2 Polyclonal Antibody
RD89188A-01 60 μL

MAN2A2 Polyclonal Antibody

Sign In for Pricing
View Details
MAN2A2 Polyclonal Antibody
RD89188A-02 120 μL

MAN2A2 Polyclonal Antibody

Sign In for Pricing
View Details
MAN2A2 Polyclonal Antibody
RD89188A-03 200 µL

MAN2A2 Polyclonal Antibody

Sign In for Pricing
View Details