Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPH1, Human (HEK293, His)

The NXPH1 protein resembles a neuropeptide and may affect cell signaling by binding to alpha-neurotoxins and other potential receptors. Although the specific mechanisms and downstream effects remain unclear, the neuropeptide-like characteristics of NXPH1 suggest that it plays a role in regulating cell signaling pathways. NXPH1 Protein, Human (HEK293, His) is the recombinant human-derived NXPH1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

NXPH1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nxph1-protein-human-hek-293-his.html

Purity

90.0

Smiles

ANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG

Molecular Formula

30010 (Gene_ID) P58417 (A22-G271) (Accession)

Molecular Weight

45-58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nudt16l1 (NM_025839) Mouse Tagged Lenti ORF Clone
MR217702L3 10 µg

Nudt16l1 (NM_025839) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TNFSF15 Protein Lysate (Rat) with C-HA Tag
47228036 100 µg

TNFSF15 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Antifungal agent 74
HY-156251 1 Each

Antifungal agent 74

Sign In for Pricing
View Details
Lentiviral mouse Tpr shRNA (UAS) - Lentiviral mouse Tpr shRNA (UAS, RFP) plasmid
GTR15212533 1 Vial

Lentiviral mouse Tpr shRNA (UAS) - Lentiviral mouse Tpr shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Quick Step Bovine Foot and Mouth Disease Virus type A Antibody (FMDV-A-Ab) elisa kit
QS0055Bo-01 48 Tests

Quick Step Bovine Foot and Mouth Disease Virus type A Antibody (FMDV-A-Ab) elisa kit

Sign In for Pricing
View Details
Quick Step Bovine Foot and Mouth Disease Virus type A Antibody (FMDV-A-Ab) elisa kit
QS0055Bo-02 96 Tests

Quick Step Bovine Foot and Mouth Disease Virus type A Antibody (FMDV-A-Ab) elisa kit

Sign In for Pricing
View Details