Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPH1, Human (HEK293, His)

The NXPH1 protein resembles a neuropeptide and may affect cell signaling by binding to alpha-neurotoxins and other potential receptors. Although the specific mechanisms and downstream effects remain unclear, the neuropeptide-like characteristics of NXPH1 suggest that it plays a role in regulating cell signaling pathways. NXPH1 Protein, Human (HEK293, His) is the recombinant human-derived NXPH1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

NXPH1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nxph1-protein-human-hek-293-his.html

Purity

90.0

Smiles

ANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG

Molecular Formula

30010 (Gene_ID) P58417 (A22-G271) (Accession)

Molecular Weight

45-58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DSPE-Se-Se-PEG-MAL
MPL0437K Each

DSPE-Se-Se-PEG-MAL

Sign In for Pricing
View Details
Rabbit Anti-Human MYLIP pAb
PA14583-01 50 μL

Rabbit Anti-Human MYLIP pAb

Sign In for Pricing
View Details
Rabbit Anti-Human MYLIP pAb
PA14583-02 100 μL

Rabbit Anti-Human MYLIP pAb

Sign In for Pricing
View Details
Insulin ELISA Kit
955672 96 Tests

Insulin ELISA Kit

Sign In for Pricing
View Details
Recombinant Rhesus Macaque SPATA4 Protein, His (Fc)-Avi-tagged
SPATA4-4241R 50 µg

Recombinant Rhesus Macaque SPATA4 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
NMT2 Knockout 786-O Polyclonal Cells
ARG5059 1 Million

NMT2 Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details