Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPH1, Human (HEK293, His)

The NXPH1 protein resembles a neuropeptide and may affect cell signaling by binding to alpha-neurotoxins and other potential receptors. Although the specific mechanisms and downstream effects remain unclear, the neuropeptide-like characteristics of NXPH1 suggest that it plays a role in regulating cell signaling pathways. NXPH1 Protein, Human (HEK293, His) is the recombinant human-derived NXPH1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

NXPH1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nxph1-protein-human-hek-293-his.html

Purity

90.0

Smiles

ANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG

Molecular Formula

30010 (Gene_ID) P58417 (A22-G271) (Accession)

Molecular Weight

45-58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC16 (Mucin-16, MUC-16, CA-125, Ovarian Cancer-related Tumor Marker CA125, Ovarian Carcinoma Antigen CA125, CA125, FLJ14303) (MaxLight 650)
MBS6264980-01 0.1 mL

MUC16 (Mucin-16, MUC-16, CA-125, Ovarian Cancer-related Tumor Marker CA125, Ovarian Carcinoma Antigen CA125, CA125, FLJ14303) (MaxLight 650)

Sign In for Pricing
View Details
MUC16 (Mucin-16, MUC-16, CA-125, Ovarian Cancer-related Tumor Marker CA125, Ovarian Carcinoma Antigen CA125, CA125, FLJ14303) (MaxLight 650)
MBS6264980-02 5x 0.1 mL

MUC16 (Mucin-16, MUC-16, CA-125, Ovarian Cancer-related Tumor Marker CA125, Ovarian Carcinoma Antigen CA125, CA125, FLJ14303) (MaxLight 650)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Alkaline Phosphatase, Intestinal (ALPI)
MBS2119864-01 0.1 mL

APC-Linked Polyclonal Antibody to Alkaline Phosphatase, Intestinal (ALPI)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Alkaline Phosphatase, Intestinal (ALPI)
MBS2119864-02 0.2 mL

APC-Linked Polyclonal Antibody to Alkaline Phosphatase, Intestinal (ALPI)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Alkaline Phosphatase, Intestinal (ALPI)
MBS2119864-03 0.5 mL

APC-Linked Polyclonal Antibody to Alkaline Phosphatase, Intestinal (ALPI)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Alkaline Phosphatase, Intestinal (ALPI)
MBS2119864-04 1 mL

APC-Linked Polyclonal Antibody to Alkaline Phosphatase, Intestinal (ALPI)

Sign In for Pricing
View Details