Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPH1, Human (HEK293, His)

The NXPH1 protein resembles a neuropeptide and may affect cell signaling by binding to alpha-neurotoxins and other potential receptors. Although the specific mechanisms and downstream effects remain unclear, the neuropeptide-like characteristics of NXPH1 suggest that it plays a role in regulating cell signaling pathways. NXPH1 Protein, Human (HEK293, His) is the recombinant human-derived NXPH1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

NXPH1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nxph1-protein-human-hek-293-his.html

Purity

90.0

Smiles

ANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG

Molecular Formula

30010 (Gene_ID) P58417 (A22-G271) (Accession)

Molecular Weight

45-58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C21ORF13 antibody
70R-1973 50 ug

C21ORF13 antibody

Sign In for Pricing
View Details
Human Occludin IgG (OCLN IgG) ELISA Kit
abx055942 96 Tests

Human Occludin IgG (OCLN IgG) ELISA Kit

Sign In for Pricing
View Details
LOC360933 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV643268 1.0 µg DNA

LOC360933 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
ULK1 (Unc-51-like Kinase 1, Serine/threonine-protein Kinase ULK1, Autophagy-related Protein 1 Homolog, ATG1, hATG1, KIAA0722) (MaxLight 405) discontinued
135089-ML405 100 µL

ULK1 (Unc-51-like Kinase 1, Serine/threonine-protein Kinase ULK1, Autophagy-related Protein 1 Homolog, ATG1, hATG1, KIAA0722) (MaxLight 405) discontinued

Sign In for Pricing
View Details
S-Acenocoumarol
258700-01 1 mg

S-Acenocoumarol

Sign In for Pricing
View Details
S-Acenocoumarol
258700-02 2 mg

S-Acenocoumarol

Sign In for Pricing
View Details