Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPH1, Human (HEK293, His)

The NXPH1 protein resembles a neuropeptide and may affect cell signaling by binding to alpha-neurotoxins and other potential receptors. Although the specific mechanisms and downstream effects remain unclear, the neuropeptide-like characteristics of NXPH1 suggest that it plays a role in regulating cell signaling pathways. NXPH1 Protein, Human (HEK293, His) is the recombinant human-derived NXPH1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

NXPH1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nxph1-protein-human-hek-293-his.html

Purity

90.0

Smiles

ANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG

Molecular Formula

30010 (Gene_ID) P58417 (A22-G271) (Accession)

Molecular Weight

45-58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pirh2 Mouse Monoclonal Antibody
AMM80813-01 1 Each

Pirh2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Pirh2 Mouse Monoclonal Antibody
AMM80813-02 50 µL

Pirh2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Pirh2 Mouse Monoclonal Antibody
AMM80813-03 100 µL

Pirh2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Chicken Engulfment And Cell Motility 2 (ELMO2) ELISA Kit
abx356820 96 Well

Chicken Engulfment And Cell Motility 2 (ELMO2) ELISA Kit

Sign In for Pricing
View Details
CCDC102B ORF Vector (Human) (pORF)
ORF001935 1.0 µg DNA

CCDC102B ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
TSPY3 Rabbit pAb
A6270 200 µL

TSPY3 Rabbit pAb

Sign In for Pricing
View Details