Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPH1, Human (HEK293, His)

The NXPH1 protein resembles a neuropeptide and may affect cell signaling by binding to alpha-neurotoxins and other potential receptors. Although the specific mechanisms and downstream effects remain unclear, the neuropeptide-like characteristics of NXPH1 suggest that it plays a role in regulating cell signaling pathways. NXPH1 Protein, Human (HEK293, His) is the recombinant human-derived NXPH1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

NXPH1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nxph1-protein-human-hek-293-his.html

Purity

90.0

Smiles

ANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG

Molecular Formula

30010 (Gene_ID) P58417 (A22-G271) (Accession)

Molecular Weight

45-58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPN1 Antibody
A32435-50UL 50 μL

PTPN1 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal RPL27A Antibody
NBP2-38025-25ul 25 µL

Rabbit Polyclonal RPL27A Antibody

Sign In for Pricing
View Details
Rat Monoclonal Tryptase alpha/TPS1 Antibody (RM0355-10H34) [Biotin]
NBP2-11983B 0.1 mL

Rat Monoclonal Tryptase alpha/TPS1 Antibody (RM0355-10H34) [Biotin]

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) DJ1D Polyclonal Antibody
MBS7186370 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) DJ1D Polyclonal Antibody

Sign In for Pricing
View Details
ERP44 ORF Vector (Human) (pORF)
ORF003644 1.0 µg DNA

ERP44 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
DFFA (C-Term) Rabbit pAb
MBS8559069-01 0.1 mL

DFFA (C-Term) Rabbit pAb

Sign In for Pricing
View Details