Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPH1, Human (HEK293, His)

The NXPH1 protein resembles a neuropeptide and may affect cell signaling by binding to alpha-neurotoxins and other potential receptors. Although the specific mechanisms and downstream effects remain unclear, the neuropeptide-like characteristics of NXPH1 suggest that it plays a role in regulating cell signaling pathways. NXPH1 Protein, Human (HEK293, His) is the recombinant human-derived NXPH1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

NXPH1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nxph1-protein-human-hek-293-his.html

Purity

90.0

Smiles

ANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG

Molecular Formula

30010 (Gene_ID) P58417 (A22-G271) (Accession)

Molecular Weight

45-58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

mLh1 (NM_026810) Mouse Tagged ORF Clone
MG210511 10 µg

mLh1 (NM_026810) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Sva (NM_009299) Mouse Tagged Lenti ORF Clone
MR214416L4 10 µg

Sva (NM_009299) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MYOG (Myogenin (Myogenic Factor 4), MYF4, MYOGENIN, bHLHc3) (MaxLight 750) discontinued
249096-ML750 100 µL

MYOG (Myogenin (Myogenic Factor 4), MYF4, MYOGENIN, bHLHc3) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Letm1 (NM_001005884) Rat Untagged Clone
RN202618 10 µg

Letm1 (NM_001005884) Rat Untagged Clone

Sign In for Pricing
View Details
sodium palmitoyl glutamate
MBS5784178 Inquire

sodium palmitoyl glutamate

Sign In for Pricing
View Details
Rabbit Anti-CENPX Polyclonal Antibody
PAV5927 100 μL

Rabbit Anti-CENPX Polyclonal Antibody

Sign In for Pricing
View Details