Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPH1, Human (HEK293, His)

The NXPH1 protein resembles a neuropeptide and may affect cell signaling by binding to alpha-neurotoxins and other potential receptors. Although the specific mechanisms and downstream effects remain unclear, the neuropeptide-like characteristics of NXPH1 suggest that it plays a role in regulating cell signaling pathways. NXPH1 Protein, Human (HEK293, His) is the recombinant human-derived NXPH1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

NXPH1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nxph1-protein-human-hek-293-his.html

Purity

90.0

Smiles

ANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG

Molecular Formula

30010 (Gene_ID) P58417 (A22-G271) (Accession)

Molecular Weight

45-58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnf4 (NM_019182) Rat Tagged ORF Clone
RR204755 10 µg

Rnf4 (NM_019182) Rat Tagged ORF Clone

Sign In for Pricing
View Details
RHBDL2 siRNA Oligos set (Human)
39499171 3x 5 nmol

RHBDL2 siRNA Oligos set (Human)

Sign In for Pricing
View Details
OSTM1, CT (OSTM1, GL, Osteopetrosis-associated transmembrane protein 1, Chloride channel 7 beta subunit) (MaxLight 490)
MBS6329796-01 0.1 mL

OSTM1, CT (OSTM1, GL, Osteopetrosis-associated transmembrane protein 1, Chloride channel 7 beta subunit) (MaxLight 490)

Sign In for Pricing
View Details
OSTM1, CT (OSTM1, GL, Osteopetrosis-associated transmembrane protein 1, Chloride channel 7 beta subunit) (MaxLight 490)
MBS6329796-02 5x 0.1 mL

OSTM1, CT (OSTM1, GL, Osteopetrosis-associated transmembrane protein 1, Chloride channel 7 beta subunit) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Laminin Alpha 1 (LAMA1)
SIPA242Hu03-01 10 µg

Recombinant Laminin Alpha 1 (LAMA1)

Sign In for Pricing
View Details
Recombinant Laminin Alpha 1 (LAMA1)
SIPA242Hu03-02 50 µg

Recombinant Laminin Alpha 1 (LAMA1)

Sign In for Pricing
View Details