Question 1

What is the catalog number for HNRPA3 Blocking Peptide?

Accepted Answer

The catalog number for HNRPA3 Blocking Peptide is 33R-5978.

Question 2

What sizes are available for HNRPA3 Blocking Peptide?

Accepted Answer

HNRPA3 Blocking Peptide is available in the following size(s): 0.1 mg.

Question 3

Is HNRPA3 Blocking Peptide in stock?

Accepted Answer

HNRPA3 Blocking Peptide is currently made to order / not held in immediate stock. Contact us for lead time.

Question 4

Is this product classed as hazardous or restricted for shipping?

Accepted Answer

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Question 5

Can you help me confirm if this product is right for my specific experiment?

Accepted Answer

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

Question 6

What is the purity of this recombinant protein?

Accepted Answer

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

HNRPA3 Blocking Peptide

Product Specifications

Controlled

Frequently Asked Questions

Explore Other Products

RPL21P92 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH

H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH

H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH

Human UBASH3B Knockout A549 cell line

Rabbit Anti-Human CD11a/ITGAL Antibody (SAA0004)