Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Testosterone 19 antibody

Product Specifications

Shipping Conditions

Cool Pack

Controlled

No

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human OR2L2 sgRNA gene knockout kit - Lentiviral human OR2L2 sgRNA gene knockout kit (plasmid)

GTR15399488 1 Vial

Lentiviral human OR2L2 sgRNA gene knockout kit - Lentiviral human OR2L2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing

Phospho-PTEN (Ser380 + Thr382 + Thr383) Rabbit Polyclonal Antibody (BF555)

orb1593056 100 µL

Phospho-PTEN (Ser380 + Thr382 + Thr383) Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing

Human SP2 Transcription Factor (SP2) ELISA Kit

abx383386 96 Tests

Human SP2 Transcription Factor (SP2) ELISA Kit

Sign In for Pricing

COL4A6 (Collagen Type VI alpha 2, Collagen alpha-6 (IV) Chain, CXDELq22.3, DELXq22.3, MGC88184) (MaxLight 490)

137863-ML490 100 µL

COL4A6 (Collagen Type VI alpha 2, Collagen alpha-6 (IV) Chain, CXDELq22.3, DELXq22.3, MGC88184) (MaxLight 490)

Sign In for Pricing

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

T76250-01 5 mg

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

T76250-02 50 mg

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing