Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Chitinase-3-like protein 4 (Chi3l4)

Product Specifications

Product Name Alternative

Chitinase-3-like protein 4 Secreted protein Ym2

Abbreviation

Recombinant Mouse Chil4 protein

Gene Name

Chil4

UniProt

Q91Z98

Expression Region

22-402aa

Organism

Mus musculus (Mouse)

Target Sequence

YQLMCYYTSWAKDRPTEGSFKPGNIDPCLCTHLIYAFAGMKNNEITYLSEQDLRDYEALNGLKDRNTELKTLLAIGGWKFGPAPFSSMVSTPQNRQTFIKSVIRFLRQYNFDGLNLDWQYPGSRGSPPKDKHLFSVLVQEMRKAFEEESTLNHIPRLLLTSTGAGFIDVIKSGYKIPELSQSLDYIQVMTYDLHDPKNGYTGENSPLYKSPYDIGKSADLNVDSIITYWKDHGAASEKLIVGFPAYGHTFILSDPSKNGIGDPTVSAGPPGKYTNEQGLLAYFEICTFLNEGATEIFDATQEVPYAYLGNEWVGYDNVRSFKLKAQWLKDNNLGGAVVWPLDMDDFSGSFCHQGRFPLTTTLKRDLNVHSASCKASYRGEL

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Immunology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

44.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NT5DC2 Knockout Hela Polyclonal Cells
ARG7969 1 Million

NT5DC2 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
USF1 (Upstream Stimulatory Factor 1, Class B Basic Helix-loop-helix Protein 11, bHLHb11, Major Late Transcription Factor 1, USF) (MaxLight 550)
MBS6398146-01 0.1 mL

USF1 (Upstream Stimulatory Factor 1, Class B Basic Helix-loop-helix Protein 11, bHLHb11, Major Late Transcription Factor 1, USF) (MaxLight 550)

Sign In for Pricing
View Details
USF1 (Upstream Stimulatory Factor 1, Class B Basic Helix-loop-helix Protein 11, bHLHb11, Major Late Transcription Factor 1, USF) (MaxLight 550)
MBS6398146-02 5x 0.1 mL

USF1 (Upstream Stimulatory Factor 1, Class B Basic Helix-loop-helix Protein 11, bHLHb11, Major Late Transcription Factor 1, USF) (MaxLight 550)

Sign In for Pricing
View Details
TM7SF1 (GPR137B) Rabbit Polyclonal Antibody
TA308709 100 µL

TM7SF1 (GPR137B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MRPS11 Human shRNA Plasmid Kit (Locus ID 64963)
TR303155 1 Kit

MRPS11 Human shRNA Plasmid Kit (Locus ID 64963)

Sign In for Pricing
View Details
Recombinant Rhodobacter sphaeroides Prolipoprotein diacylglyceryl transferase (lgt)
MBS7018692-01 0.02 mg

Recombinant Rhodobacter sphaeroides Prolipoprotein diacylglyceryl transferase (lgt)

Sign In for Pricing
View Details