Animal-Free IL-17F, Mouse (His)
IL-17F Protein, a cytokine belonging to the IL-17 family, is produced using recombinant DNA technology without the use of animal-derived materials. It is involved in inflammatory responses and immune regulation. IL-17F Protein offers a safe and ethical alternative for research and therapeutic applications, addressing concerns related to animal-based production methods. Animal-Free IL-17F Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-17F protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free IL-17F Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-il-17f-protein-mouse-his.html
Purity
95.0
Smiles
MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA
Molecular Formula
257630 (Gene_ID) Q7TNI7-1 (R29-A161) (Accession)
Molecular Weight
Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
Cytokeratin 10/13 (DE-K13), CF405S conjugate, 0.1mg/mL
