Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C chemokine receptor type 4 (CXCR4), partial

Product Specifications

Product Name Alternative

CXC-R4; CXCR-4; FB22; Fusin; HM89; LCR1; Leukocyte-derived seven transmembrane domain receptor; LESTR; Lipopolysaccharide-associated protein 3; LAP-3; LPS-associated protein 3; NPYRL; Stromal cell-derived factor 1 receptor; SDF-1 receptor; CD antigen CD184

Abbreviation

Recombinant Human CXCR4 protein, partial

Gene Name

CXCR4

UniProt

P61073

Expression Region

303-352aa

Organism

Homo sapiens (Human)

Target Sequence

PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS

Tag

N-terminal 6xHis-GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Involved in the AKT signaling cascade. Plays a role in regulation of cell migration, e.g. during wound healing. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion by monocytes. Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival. ; (Microbial infection) Acts as a coreceptor (CD4 being the primary receptor) for human immunodeficiency virus-1/HIV-1 X4 isolates and as a primary receptor for some HIV-2 isolates. Promotes Env-mediated fusion of the virus.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform 2

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) SLD7 Polyclonal Antibody
MBS7197114 Inquire

Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) SLD7 Polyclonal Antibody

Ask
View Details
FKBP7 (NM_181342) Human Recombinant Protein
PH41009M5 20 µg

FKBP7 (NM_181342) Human Recombinant Protein

Ask
View Details
GLIPR1L1, CT (GLIPR1L1, GLIPR1-like protein 1) (Biotin) discontinued
036079-Biotin 200 µL

GLIPR1L1, CT (GLIPR1L1, GLIPR1-like protein 1) (Biotin) discontinued

Ask
View Details
FAM59A (GAREM1) Human shRNA Plasmid Kit (Locus ID 64762)
TG304636 1 Kit

FAM59A (GAREM1) Human shRNA Plasmid Kit (Locus ID 64762)

Ask
View Details
(+) -2-Amino-6-propionamido-d3-tetrahydrobenzothiazole
002499 2.5 mg

(+) -2-Amino-6-propionamido-d3-tetrahydrobenzothiazole

Ask
View Details
Human ARF3 qPCR Primer Pair
QH10505S 200 Tests

Human ARF3 qPCR Primer Pair

Ask
View Details