Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thrombopoietin (THPO) (Active)

Product Specifications

Product Name Alternative

Thrombopoietin; C-mpl ligand; Megakaryocyte colony-stimulating factor; Megakaryocyte growth and development factor; Myeloproliferative leukemia virus oncogene ligand; THPO

Abbreviation

Recombinant Human THPO protein (Active)

Gene Name

THPO

UniProt

P40225

Expression Region

22-353aa

Organism

Homo sapiens (Human)

Target Sequence

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Tag

N-terminal 6xHis-tagged and C-terminal 6xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Thrombopoietin (TPO) is a glycoprotein hormone which belongs to the EPO/TPO family. It produced by the liver and kidney which regulates the production of platelets. TPO stimulates the production and differentiation of megakaryocytes, the bone marrow cells that bud off large numbers of platelets. Lineage-specific cytokine affects the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined in a cell proliferation assay using MO7E human megakaryocytic leukemic cells is 0.55 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.

Molecular Weight

37.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-3/HER3 (C-Fc)
PKSH033995-01 10 µg

Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-3/HER3 (C-Fc)

Sign In for Pricing
View Details
Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-3/HER3 (C-Fc)
PKSH033995-02 50 µg

Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-3/HER3 (C-Fc)

Sign In for Pricing
View Details
Retinoid X Receptor beta (RXRB) (Center) Rabbit Polyclonal Antibody
AP53774PU-N 400 µL

Retinoid X Receptor beta (RXRB) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAL (NM_002371) Human Over-expression Lysate
LC400850 20 µg

MAL (NM_002371) Human Over-expression Lysate

Sign In for Pricing
View Details
PTFE-Coated Sealing Mats
SLT-RD-96-PTFE 50 Pack/Case

PTFE-Coated Sealing Mats

Sign In for Pricing
View Details
General Cortisol (Cor) ELISA Kit
RDR-Cortisol-Ge-01 96 Tests

General Cortisol (Cor) ELISA Kit

Sign In for Pricing
View Details