Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Putative phospholipase B-like 2 (Plbd2)

Product Specifications

Product Name Alternative

66.3KDA protein76KDA protein ; p76LAMA-like protein 2Lamina ancestor homolog 2; Phospholipase B domain-containing protein 2

Abbreviation

Recombinant Mouse Plbd2 protein

Gene Name

Plbd2

UniProt

Q3TCN2

Expression Region

47-594aa

Organism

Mus musculus (Mouse)

Target Sequence

LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDYKAFLPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFETVFNASGLQALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYNDFLHDPLSLCEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGIDVKVTSFTLAKYMSMLAASGPTWDQCPPFQWSKSPFHSMLHMGQPDLWMFSPIRVPWD

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Others

Relevance

Putative phospholipase.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

64.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 6A (KRT6A) (Basal Cell Marker) (rKRT6A/2100), CF405S conjugate, 0.1mg/mL
BNC043799-500 1x 500 µL

Cytokeratin 6A (KRT6A) (Basal Cell Marker) (rKRT6A/2100), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ANGPTL1 Mouse Monoclonal Antibody [Clone ID: OTI1B2]
CF805608 100 µg

ANGPTL1 Mouse Monoclonal Antibody [Clone ID: OTI1B2]

Sign In for Pricing
View Details
CD4 (T-Helper/Inducer Cell Marker) (CD4/1604), CF405S conjugate, 0.1mg/mL
BNC041604-100 1x 100 µL

CD4 (T-Helper/Inducer Cell Marker) (CD4/1604), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF405S conjugate, 0.1mg/mL
BNC042278-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SLFN5 Human Gene Knockout Kit (CRISPR)
KN416330 1 Kit

SLFN5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human RASL12 activation kit by CRISPRa
GA109705 1 Kit

Human RASL12 activation kit by CRISPRa

Sign In for Pricing
View Details