Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTACK/CCL27, Mouse

CTACK/CCL27 protein attracts skin-associated memory T-lymphocytes, mediating lymphocyte homing to the skin. It may also participate in embryonic cell migration. Nuclear forms of CCL27 induce cytoskeletal relaxation. The protein binds to CCR10, exists in monomeric, dimeric, and tetrameric forms, and heparin promotes oligomerization. Additionally, CCL27 interacts with TNFAIP6 through its Link domain. CTACK/CCL27 Protein, Mouse is the recombinant mouse-derived CTACK/CCL27 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

CTACK/CCL27 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl27-protein-mouse.html

Purity

96.00

Smiles

LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSHPQQQN

Molecular Formula

20301 (Gene_ID) Q9Z1X0-1 (L26-N120) (Accession)

Molecular Weight

Approximately 10-14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Interleukin-17A/IL-17A Protein
PKSH032620-01 20 µg

Recombinant Human Interleukin-17A/IL-17A Protein

Sign In for Pricing
View Details
Recombinant Human Interleukin-17A/IL-17A Protein
PKSH032620-02 100 µg

Recombinant Human Interleukin-17A/IL-17A Protein

Sign In for Pricing
View Details
Olfactory receptor 13C8 (OR13C8) (NM_001004483) Human Over-expression Lysate
LC423786 20 µg

Olfactory receptor 13C8 (OR13C8) (NM_001004483) Human Over-expression Lysate

Sign In for Pricing
View Details
GSK 2126458
TRC-G797500-1MG 1 mg

GSK 2126458

Sign In for Pricing
View Details
C22orf28 (RTCB) Rabbit Polyclonal Antibody
TA381178 100 µL

C22orf28 (RTCB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ADAM28 Mouse Monoclonal Antibody [Clone ID: OTI6C6]
CF812686 100 µg

ADAM28 Mouse Monoclonal Antibody [Clone ID: OTI6C6]

Sign In for Pricing
View Details