Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTACK/CCL27, Mouse

CTACK/CCL27 protein attracts skin-associated memory T-lymphocytes, mediating lymphocyte homing to the skin. It may also participate in embryonic cell migration. Nuclear forms of CCL27 induce cytoskeletal relaxation. The protein binds to CCR10, exists in monomeric, dimeric, and tetrameric forms, and heparin promotes oligomerization. Additionally, CCL27 interacts with TNFAIP6 through its Link domain. CTACK/CCL27 Protein, Mouse is the recombinant mouse-derived CTACK/CCL27 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

CTACK/CCL27 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl27-protein-mouse.html

Purity

96.00

Smiles

LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSHPQQQN

Molecular Formula

20301 (Gene_ID) Q9Z1X0-1 (L26-N120) (Accession)

Molecular Weight

Approximately 10-14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ms4a4b (BC028433) Mouse Tagged ORF Clone
MG200489 10 µg

Ms4a4b (BC028433) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
FAM91A1 Rabbit Polyclonal Antibody
TA368305 100 µL

FAM91A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phloroglucinol-13C6
TRC-P340002-1MG 1 mg

Phloroglucinol-13C6

Sign In for Pricing
View Details
2,4,6-Tribromophenyl Acetate
TRC-T772625-2.5G 2.5 g

2,4,6-Tribromophenyl Acetate

Sign In for Pricing
View Details
Vmn1r222 Mouse Gene Knockout Kit (CRISPR)
KN519017 1 Kit

Vmn1r222 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MCU Recombinant Rabbit monoclonal Antibody
HA751487 100 µL

MCU Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details