Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTACK/CCL27, Mouse

CTACK/CCL27 protein attracts skin-associated memory T-lymphocytes, mediating lymphocyte homing to the skin. It may also participate in embryonic cell migration. Nuclear forms of CCL27 induce cytoskeletal relaxation. The protein binds to CCR10, exists in monomeric, dimeric, and tetrameric forms, and heparin promotes oligomerization. Additionally, CCL27 interacts with TNFAIP6 through its Link domain. CTACK/CCL27 Protein, Mouse is the recombinant mouse-derived CTACK/CCL27 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

CTACK/CCL27 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl27-protein-mouse.html

Purity

96.00

Smiles

LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSHPQQQN

Molecular Formula

20301 (Gene_ID) Q9Z1X0-1 (L26-N120) (Accession)

Molecular Weight

Approximately 10-14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stackable CO2 Incubator Shaker
SI-960 1 Unit

Stackable CO2 Incubator Shaker

Sign In for Pricing
View Details
Caspase 9 (CASP9) (1-250) Mouse Monoclonal Antibody [Clone ID: 5B4]
AM26603AF-N 100 µg

Caspase 9 (CASP9) (1-250) Mouse Monoclonal Antibody [Clone ID: 5B4]

Sign In for Pricing
View Details
PNPLA4 (NM_004650) Human Over-expression Lysate
LY401474 100 µg

PNPLA4 (NM_004650) Human Over-expression Lysate

Sign In for Pricing
View Details
Boc-L-His(Tos)-OH
TRC-B391815-5G 5 g

Boc-L-His(Tos)-OH

Sign In for Pricing
View Details
TRIM29 Mouse Monoclonal Antibody [Clone ID: OTI8D12]
CF812273 100 µg

TRIM29 Mouse Monoclonal Antibody [Clone ID: OTI8D12]

Sign In for Pricing
View Details
HPDL (NM_032756) Human Recombinant Protein
TP303550M 100 µg

HPDL (NM_032756) Human Recombinant Protein

Sign In for Pricing
View Details