Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF13B, Human (HEK293, Fc)

TNFRSF13B protein is a receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS and exhibits high-affinity binding to both ligands. Its activation stimulates B-cell and T-cell function and modulates humoral immunity through calcineurin-dependent NF-AT activation as well as NF-kappa-B and AP-1 activation. TNFRSF13B Protein, Human (HEK293, Fc) is the recombinant human-derived TNFRSF13B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TNFRSF13B Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrsf13b-protein-human-hek-293-fc.html

Purity

93.00

Smiles

SGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYST

Molecular Formula

23495 (Gene_ID) O14836-1 (S2­T166) (Accession)

Molecular Weight

50-54 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab27b Adenovirus (Mouse)
38316055 1.0 mL

Rab27b Adenovirus (Mouse)

Sign In for Pricing
View Details
MRP-L40 Polyclonal Antibody
E20-72862 100 µg

MRP-L40 Polyclonal Antibody

Sign In for Pricing
View Details
Tyrosine-protein Kinase Fes/Fps (FES) Cat ELISA Kit
H9726 96 Tests

Tyrosine-protein Kinase Fes/Fps (FES) Cat ELISA Kit

Sign In for Pricing
View Details
MCCC1 Rabbit Polyclonal Antibody (Fluoro647)
orb3100214 100 µg

MCCC1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
MST1R Protein Vector (Mouse) (pPB-C-His)
PV202502 500 ng

MST1R Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
ZNF256 Protein Vector (Human) (pPB-C-His)
PV047553 500 ng

ZNF256 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details