COL6A3, Human (HEK293, His)
COL6A3 protein is an important component of type VI collagen and has the function of a cell-binding protein. Collagen VI trimers are composed of three distinct chains: alpha-1 (VI), alpha-2 (VI), and alpha-3 (VI), alpha-5 (VI), or alpha-6 (VI) . COL6A3 Protein, Human (HEK293, His) is the recombinant human-derived COL6A3 protein, expressed by HEK293 , with N-His labeled tag.
Product Specifications
Product Name Alternative
COL6A3 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/col6a3-protein-human-hek293-his.html
Purity
96.00
Smiles
TEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT
Molecular Formula
1293 (Gene_ID) P12111-1 (T3101-T3177) (Accession)
Molecular Weight
Approximately 13 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Magic™ Membrane Protein Human OR2L3 (Olfactory receptor family 2 subfamily L member 3) Expressed in vitro E.coli expression system, Full Length
Recombinant Chlorobium tepidum Tyrosine recombinase XerD (xerD)
Recombinant Chlorobium tepidum Tyrosine recombinase XerD (xerD)
Recombinant Chlorobium tepidum Tyrosine recombinase XerD (xerD)
Recombinant Chlorobium tepidum Tyrosine recombinase XerD (xerD)