Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL6A3, Human (HEK293, His)

COL6A3 protein is an important component of type VI collagen and has the function of a cell-binding protein. Collagen VI trimers are composed of three distinct chains: alpha-1 (VI), alpha-2 (VI), and alpha-3 (VI), alpha-5 (VI), or alpha-6 (VI) . COL6A3 Protein, Human (HEK293, His) is the recombinant human-derived COL6A3 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

COL6A3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/col6a3-protein-human-hek293-his.html

Purity

96.00

Smiles

TEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT

Molecular Formula

1293 (Gene_ID) P12111-1 (T3101-T3177) (Accession)

Molecular Weight

Approximately 13 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

4932411N23Rik Mouse shRNA Plasmid (Locus ID 237029)
TL514181 1 Kit

4932411N23Rik Mouse shRNA Plasmid (Locus ID 237029)

Sign In for Pricing
View Details
ASB13 Protein (N-His, Human)
P513311 100 µg

ASB13 Protein (N-His, Human)

Sign In for Pricing
View Details
CD8 recombinant monoclonal antibody
A5113 100ul X 3

CD8 recombinant monoclonal antibody

Sign In for Pricing
View Details
Eco130I (StyI)
MBS638481-01 2500 Units

Eco130I (StyI)

Sign In for Pricing
View Details
Eco130I (StyI)
MBS638481-02 5x 2500 Units

Eco130I (StyI)

Sign In for Pricing
View Details
Lentiviral human LEP shRNA (UAS) - Lentiviral human LEP shRNA (UAS, GFP) plasmid
GTR15160450 1 Vial

Lentiviral human LEP shRNA (UAS) - Lentiviral human LEP shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details