Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL6A3, Human (HEK293, His)

COL6A3 protein is an important component of type VI collagen and has the function of a cell-binding protein. Collagen VI trimers are composed of three distinct chains: alpha-1 (VI), alpha-2 (VI), and alpha-3 (VI), alpha-5 (VI), or alpha-6 (VI) . COL6A3 Protein, Human (HEK293, His) is the recombinant human-derived COL6A3 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

COL6A3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/col6a3-protein-human-hek293-his.html

Purity

96.00

Smiles

TEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT

Molecular Formula

1293 (Gene_ID) P12111-1 (T3101-T3177) (Accession)

Molecular Weight

Approximately 13 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Septin 3 discontinued
542180-01 30ul

Septin 3 discontinued

Sign In for Pricing
View Details
Septin 3 discontinued
542180-02 100 µL

Septin 3 discontinued

Sign In for Pricing
View Details
Recombinant Borrelia Garinii rplW Protein (aa 1-98)
VAng-Lsx2089-50gEcoli 50 µg (E. coli)

Recombinant Borrelia Garinii rplW Protein (aa 1-98)

Sign In for Pricing
View Details
Recombinant Clostridium Kluyveri aspS Protein (aa 1-590) (strain ATCC 8527 / DSM 555 / NCIMB 10680)
VAng-Lsx9423-inquire Inquire

Recombinant Clostridium Kluyveri aspS Protein (aa 1-590) (strain ATCC 8527 / DSM 555 / NCIMB 10680)

Sign In for Pricing
View Details
SNX9 Antibody, HRP conjugated
A72280-100UG 100 µg

SNX9 Antibody, HRP conjugated

Sign In for Pricing
View Details
GPR75 Protein Vector (Human) (pPM-C-His)
PV018524 500 ng

GPR75 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details