Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL6A3, Human (HEK293, His)

COL6A3 protein is an important component of type VI collagen and has the function of a cell-binding protein. Collagen VI trimers are composed of three distinct chains: alpha-1 (VI), alpha-2 (VI), and alpha-3 (VI), alpha-5 (VI), or alpha-6 (VI) . COL6A3 Protein, Human (HEK293, His) is the recombinant human-derived COL6A3 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

COL6A3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/col6a3-protein-human-hek293-his.html

Purity

96.00

Smiles

TEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT

Molecular Formula

1293 (Gene_ID) P12111-1 (T3101-T3177) (Accession)

Molecular Weight

Approximately 13 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody (A7L6) [mFluor Violet 450 SE]
NBP2-47695MFV450 0.1 mL

Rat Monoclonal Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody (A7L6) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
2,2'-Thiobis(ethanol)-13C4
TRC-T264842-25MG 25 mg

2,2'-Thiobis(ethanol)-13C4

Sign In for Pricing
View Details
Hivep2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3651007 1.0 µg DNA

Hivep2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Human Atf4 (Activating Transcription Factor 4) ELISA Kit
FY-EH1886 96 Well

Human Atf4 (Activating Transcription Factor 4) ELISA Kit

Sign In for Pricing
View Details
ORP150; HSP12A Protein (C-His, Human)
P517337 100 µg

ORP150; HSP12A Protein (C-His, Human)

Sign In for Pricing
View Details
Mouse Monoclonal NPRA/NPR1 Antibody (OTI7H7) [PE]
NBP2-73044PE 0.1 mL

Mouse Monoclonal NPRA/NPR1 Antibody (OTI7H7) [PE]

Sign In for Pricing
View Details