Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL6A3, Human (HEK293, His)

COL6A3 protein is an important component of type VI collagen and has the function of a cell-binding protein. Collagen VI trimers are composed of three distinct chains: alpha-1 (VI), alpha-2 (VI), and alpha-3 (VI), alpha-5 (VI), or alpha-6 (VI) . COL6A3 Protein, Human (HEK293, His) is the recombinant human-derived COL6A3 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

COL6A3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/col6a3-protein-human-hek293-his.html

Purity

96.00

Smiles

TEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT

Molecular Formula

1293 (Gene_ID) P12111-1 (T3101-T3177) (Accession)

Molecular Weight

Approximately 13 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chordc1 (NM_025844) Mouse Recombinant Protein
PM43520M5 20 µg

Chordc1 (NM_025844) Mouse Recombinant Protein

Sign In for Pricing
View Details
Pectolinarin
SM2025-10mM 10 mM x 0.2 mL

Pectolinarin

Sign In for Pricing
View Details
RBBP4 Protein Vector (Rat) (pPM-C-HA)
38570026 500 ng

RBBP4 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
VPS4A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV660358 1.0 µg DNA

VPS4A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Rabbit Polyclonal SNW1 Antibody [Alexa Fluor 488]
NB100-2367AF488 0.1 mL

Rabbit Polyclonal SNW1 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus RNA polymerase sigma factor rpoD (rpoD)
MBS1228968-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus RNA polymerase sigma factor rpoD (rpoD)

Sign In for Pricing
View Details