Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL6A3, Human (HEK293, His)

COL6A3 protein is an important component of type VI collagen and has the function of a cell-binding protein. Collagen VI trimers are composed of three distinct chains: alpha-1 (VI), alpha-2 (VI), and alpha-3 (VI), alpha-5 (VI), or alpha-6 (VI) . COL6A3 Protein, Human (HEK293, His) is the recombinant human-derived COL6A3 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

COL6A3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/col6a3-protein-human-hek293-his.html

Purity

96.00

Smiles

TEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT

Molecular Formula

1293 (Gene_ID) P12111-1 (T3101-T3177) (Accession)

Molecular Weight

Approximately 13 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hebp2 (NM_001107515) Rat Tagged Lenti ORF Clone
RR210992L3 10 µg

Hebp2 (NM_001107515) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PFN1P4 Protein Vector (Human) (pPB-N-His)
PV110523 500 ng

PFN1P4 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
ABCB5 Immunizing Peptide
MBS427415-01 0.1 mg

ABCB5 Immunizing Peptide

Sign In for Pricing
View Details
ABCB5 Immunizing Peptide
MBS427415-02 5x 0.1 mg

ABCB5 Immunizing Peptide

Sign In for Pricing
View Details
Human MRI Recombinant Protein
PROTQ9BWK5-4ug 4 µg

Human MRI Recombinant Protein

Sign In for Pricing
View Details
FOXP3, ID (FOXP3, IPEX, Forkhead box protein P3, Scurfin) (MaxLight 650)
MBS6300001-01 0.1 mL

FOXP3, ID (FOXP3, IPEX, Forkhead box protein P3, Scurfin) (MaxLight 650)

Sign In for Pricing
View Details