Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL6A3, Human (HEK293, His)

COL6A3 protein is an important component of type VI collagen and has the function of a cell-binding protein. Collagen VI trimers are composed of three distinct chains: alpha-1 (VI), alpha-2 (VI), and alpha-3 (VI), alpha-5 (VI), or alpha-6 (VI) . COL6A3 Protein, Human (HEK293, His) is the recombinant human-derived COL6A3 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

COL6A3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/col6a3-protein-human-hek293-his.html

Purity

96.00

Smiles

TEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT

Molecular Formula

1293 (Gene_ID) P12111-1 (T3101-T3177) (Accession)

Molecular Weight

Approximately 13 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CCL26/Eotaxin-3 protein, No Tag
MBS1560719-01 0.05 mg

Recombinant Human CCL26/Eotaxin-3 protein, No Tag

Sign In for Pricing
View Details
Recombinant Human CCL26/Eotaxin-3 protein, No Tag
MBS1560719-02 0.1 mg

Recombinant Human CCL26/Eotaxin-3 protein, No Tag

Sign In for Pricing
View Details
Recombinant Human CCL26/Eotaxin-3 protein, No Tag
MBS1560719-03 5x 0.1 mg

Recombinant Human CCL26/Eotaxin-3 protein, No Tag

Sign In for Pricing
View Details
CD15 antibody (biotin)
61R-1474 100 ug

CD15 antibody (biotin)

Sign In for Pricing
View Details
CD13 Protein, Human, Recombinant (603 Met/Ile, His Tag)
PH50089M2 50 µg

CD13 Protein, Human, Recombinant (603 Met/Ile, His Tag)

Sign In for Pricing
View Details
Olr823 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV633935 1.0 µg DNA

Olr823 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details