COL6A3, Human (HEK293, His)
COL6A3 protein is an important component of type VI collagen and has the function of a cell-binding protein. Collagen VI trimers are composed of three distinct chains: alpha-1 (VI), alpha-2 (VI), and alpha-3 (VI), alpha-5 (VI), or alpha-6 (VI) . COL6A3 Protein, Human (HEK293, His) is the recombinant human-derived COL6A3 protein, expressed by HEK293 , with N-His labeled tag.
Product Specifications
Product Name Alternative
COL6A3 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/col6a3-protein-human-hek293-his.html
Purity
96.00
Smiles
TEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT
Molecular Formula
1293 (Gene_ID) P12111-1 (T3101-T3177) (Accession)
Molecular Weight
Approximately 13 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
MORF4LP2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
![Rabbit Polyclonal BRSK1 Antibody [Janelia Fluor 646]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
Rabbit Polyclonal BRSK1 Antibody [Janelia Fluor 646]
![Mouse Monoclonal S100G Antibody (S100G/7516) [CoraFluor 1]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
Mouse Monoclonal S100G Antibody (S100G/7516) [CoraFluor 1]
Human IL-4 / IL-4RA Inhibitor Screening Kit (TR-FRET)
CD86 (Activation B7-2 antigen, B lymphocyte activation antigen B72, CD28 antigen ligand 2, CD28LG2, CLS1, CTLA-4 counter-receptor B7.2, Early T-cell costimulatory molecule 1, ETC-1, FUN-1, LAB72, Ly-58, MB7-2, TS/A-2) (FITC)