Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL6A3, Human (HEK293, His)

COL6A3 protein is an important component of type VI collagen and has the function of a cell-binding protein. Collagen VI trimers are composed of three distinct chains: alpha-1 (VI), alpha-2 (VI), and alpha-3 (VI), alpha-5 (VI), or alpha-6 (VI) . COL6A3 Protein, Human (HEK293, His) is the recombinant human-derived COL6A3 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

COL6A3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/col6a3-protein-human-hek293-his.html

Purity

96.00

Smiles

TEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT

Molecular Formula

1293 (Gene_ID) P12111-1 (T3101-T3177) (Accession)

Molecular Weight

Approximately 13 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

VEGF BioAssayTM ELISA Kit (Rat) (Vascular Endothelial Growth Factor, VEGF, Vascular Permeability Factor, VPF) discontinued
361431 48 Tests

VEGF BioAssayTM ELISA Kit (Rat) (Vascular Endothelial Growth Factor, VEGF, Vascular Permeability Factor, VPF) discontinued

Ask
View Details
Mouse Monoclonal CD31/PECAM-1 Antibody (C31.3) [Janelia Fluor 646]
NBP2-33154JF646 0.1 mL

Mouse Monoclonal CD31/PECAM-1 Antibody (C31.3) [Janelia Fluor 646]

Ask
View Details
Recombinant Buchnera aphidicola subsp. Schizaphis graminum Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)
MBS1289336-01 0.02 mg (E-Coli)

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)

Ask
View Details
Recombinant Buchnera aphidicola subsp. Schizaphis graminum Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)
MBS1289336-02 0.02 mg (Yeast)

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)

Ask
View Details
Recombinant Buchnera aphidicola subsp. Schizaphis graminum Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)
MBS1289336-03 0.1 mg (E-Coli)

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)

Ask
View Details
Recombinant Buchnera aphidicola subsp. Schizaphis graminum Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)
MBS1289336-04 0.1 mg (Yeast)

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Probable tRNA threonylcarbamoyladenosine biosynthesis protein Gcp (gcp)

Ask
View Details