COL6A3, Human (HEK293, His)
COL6A3 protein is an important component of type VI collagen and has the function of a cell-binding protein. Collagen VI trimers are composed of three distinct chains: alpha-1 (VI), alpha-2 (VI), and alpha-3 (VI), alpha-5 (VI), or alpha-6 (VI) . COL6A3 Protein, Human (HEK293, His) is the recombinant human-derived COL6A3 protein, expressed by HEK293 , with N-His labeled tag.
Product Specifications
Product Name Alternative
COL6A3 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/col6a3-protein-human-hek293-his.html
Purity
96.00
Smiles
TEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT
Molecular Formula
1293 (Gene_ID) P12111-1 (T3101-T3177) (Accession)
Molecular Weight
Approximately 13 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
![Rabbit Monoclonal p53R2 Antibody (077) [DyLight 755]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
Telomeric Repeat Binding Factor 1 (Telomeric Repeat Binding Factor (NIMA-interacting) 1, TERF1, TRBF1, TRF, TRF1, hTRF1-AS, t-TRF1, FLJ41416, NIMA-interacting Protein 2, PIN2, TTAGGG Repeat-binding Factor 1, Telomeric Protein Pin2/TRF1) (Biotin)
Telomeric Repeat Binding Factor 1 (Telomeric Repeat Binding Factor (NIMA-interacting) 1, TERF1, TRBF1, TRF, TRF1, hTRF1-AS, t-TRF1, FLJ41416, NIMA-interacting Protein 2, PIN2, TTAGGG Repeat-binding Factor 1, Telomeric Protein Pin2/TRF1) (Biotin)