NRAS, Human (N-His)
NRAS protein is a member of the Ras family that binds GDP/GTP and has intrinsic GTPase activity. This property enables NRAS to actively regulate cellular processes by cycling between a GDP-bound inactive state and a GTP-bound active state. NRAS Protein, Human (N-His) is the recombinant human-derived NRAS protein, expressed by E. coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
NRAS Protein, Human (N-His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/nras-protein-human-n-his.html
Purity
95.0
Smiles
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPC
Molecular Formula
4893 (Gene_ID) P01111 (M1-C186) (Accession)
Molecular Weight
Approximately 23 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680304-500 1x 500 µL
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471231-500 1x 500 µL
Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942366-100 1x 100 µL
CD269 / TNFRSF17 / BCMA (B-Cell Maturation Protein) (BCMA/2366), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941773-500 1x 500 µL
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1773R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472039-500 1x 500 µL
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2039), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details