Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRAS, Human (N-His)

NRAS protein is a member of the Ras family that binds GDP/GTP and has intrinsic GTPase activity. This property enables NRAS to actively regulate cellular processes by cycling between a GDP-bound inactive state and a GTP-bound active state. NRAS Protein, Human (N-His) is the recombinant human-derived NRAS protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

NRAS Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nras-protein-human-n-his.html

Purity

95.0

Smiles

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPC

Molecular Formula

4893 (Gene_ID) P01111 (M1-C186) (Accession)

Molecular Weight

Approximately 23 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDM1, CT (MDM1, Nuclear protein MDM1) (MaxLight 490)
MBS6319832-01 0.1 mL

MDM1, CT (MDM1, Nuclear protein MDM1) (MaxLight 490)

Sign In for Pricing
View Details
MDM1, CT (MDM1, Nuclear protein MDM1) (MaxLight 490)
MBS6319832-02 5x 0.1 mL

MDM1, CT (MDM1, Nuclear protein MDM1) (MaxLight 490)

Sign In for Pricing
View Details
RXRA (NR2B1, Retinoic Acid Receptor RXR-alpha, Nuclear Receptor Subfamily 2 Group B Member 1, Retinoid X Receptor alpha, FLJ00280, FLJ00318, FLJ16020, FLJ16733, MGC102720) (HRP)
MBS6393127-01 0.1 mL

RXRA (NR2B1, Retinoic Acid Receptor RXR-alpha, Nuclear Receptor Subfamily 2 Group B Member 1, Retinoid X Receptor alpha, FLJ00280, FLJ00318, FLJ16020, FLJ16733, MGC102720) (HRP)

Sign In for Pricing
View Details
RXRA (NR2B1, Retinoic Acid Receptor RXR-alpha, Nuclear Receptor Subfamily 2 Group B Member 1, Retinoid X Receptor alpha, FLJ00280, FLJ00318, FLJ16020, FLJ16733, MGC102720) (HRP)
MBS6393127-02 5x 0.1 mL

RXRA (NR2B1, Retinoic Acid Receptor RXR-alpha, Nuclear Receptor Subfamily 2 Group B Member 1, Retinoid X Receptor alpha, FLJ00280, FLJ00318, FLJ16020, FLJ16733, MGC102720) (HRP)

Sign In for Pricing
View Details
Akp-6 Lentiviral Activation Particles (m2)
sc-429410-LAC-2 200 µL

Akp-6 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
TRIMP1 sgRNA CRISPR Lentivector (Human) (Target 2)
K2470003 1.0 µg DNA

TRIMP1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details