Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRACC/SLAMF7, Mouse (HEK293, His)

The CRACC/SLAMF7 protein is an autoligand receptor in the SLAM family that critically regulates immune cell activation and differentiation through homotypic or heterotypic interactions. It coordinates distinct immune responses, dependent on the presence or absence of the cytoplasmic linkers SH2D1A/SAP and/or SH2D1B/EAT-2. CRACC/SLAMF7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CRACC/SLAMF7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CRACC/SLAMF7 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cracc-slamf7-protein-mouse-hek-293-his.html

Purity

99

Smiles

SGTLKKVAGALDGSVTFTLNITEIKVDYVVWTFNTFFLAMVKKDGVTSQSSNKERIVFPDGLYSMKLSQLKKNDSGAYRAEIYSTSSQASLIQEYVLHVYKHLSRPKVTIDRQSNKNGTCVINLTCSTDQDGENVTYSWKAVGQGDNQFHDGATLSIAWRSGEKDQALTCMARNPVSNSFSTPVFPQKLCEDAATDLTSLRG

Molecular Formula

75345 (Gene_ID) Q8BHK6-1 (S23-G224) (Accession)

Molecular Weight

Approximately 30-42 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1s shRNA (h) Lentiviral Particles
sc-60301-V 200 µL

C1s shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Lentiviral human AOX1 shRNA (UAS) - Lentiviral human AOX1 shRNA (UAS, RFP) (25)
GTR15318854 1 Vial

Lentiviral human AOX1 shRNA (UAS) - Lentiviral human AOX1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
MUM1 Human shRNA Plasmid Kit (Locus ID 84939)
TL303097 1 Kit

MUM1 Human shRNA Plasmid Kit (Locus ID 84939)

Sign In for Pricing
View Details
Mouse IgM Antibody
GWB-302A48 2 mg

Mouse IgM Antibody

Sign In for Pricing
View Details
G protein alpha 16 Rabbit Polyclonal Antibody (HRP)
orb478608 100 µL

G protein alpha 16 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Salmonella rdgC Protein (aa 1-303) (strain SL476)
VAng-Wyb1158-1mgEcoli 1 mg (E. coli)

Recombinant Salmonella rdgC Protein (aa 1-303) (strain SL476)

Sign In for Pricing
View Details