Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FtsZ, E.coli (His-SUMO)

FtsZ is an essential cell division protein that plays a central role in coordinating the formation of the contractile Z ring at the site of expected cell division. Precise regulation of the components of this ring is a key determinant, affecting the timing and location of cell division. FtsZ Protein, E.coli (His-SUMO) is the recombinant E. coli-derived FtsZ protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

FtsZ Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ftsz-protein-e-coli-his-sumo.html

Purity

90.0

Smiles

MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD

Molecular Formula

75202088 (Gene_ID) P0A9A7 (M1-D383) (Accession)

Molecular Weight

Approximately 56.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serpinb9e Mouse shRNA Lentiviral Particle (Locus ID 20710)
TL512556V 500 µL Each

Serpinb9e Mouse shRNA Lentiviral Particle (Locus ID 20710)

Sign In for Pricing
View Details
Anti-RNF168 Rabbit pAb
GB114412-50 50 μL

Anti-RNF168 Rabbit pAb

Sign In for Pricing
View Details
BIRC5, Human (His-SUMO)
HY-P702495-01 5 µg

BIRC5, Human (His-SUMO)

Sign In for Pricing
View Details
BIRC5, Human (His-SUMO)
HY-P702495-02 10 µg

BIRC5, Human (His-SUMO)

Sign In for Pricing
View Details
BIRC5, Human (His-SUMO)
HY-P702495-03 50 µg

BIRC5, Human (His-SUMO)

Sign In for Pricing
View Details
BIRC5, Human (His-SUMO)
HY-P702495-04 100 µg

BIRC5, Human (His-SUMO)

Sign In for Pricing
View Details