IFN-beta, Human (HEK293)
IFN-beta Protein, Human (HEK293) is a cytokine with immunomodulatory properties.IFN-beta Protein, Human (HEK293) can be used for the study of severe COVID-19 (coronavirus disease), it reduce viral load and improve lung pathology in a marmoset model[3].
Product Specifications
Product Name Alternative
IFN-beta Protein, Human (HEK293), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ifn-beta-protein-human-hek293.html
Purity
95.00
Smiles
MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Molecular Formula
3456 (Gene_ID) P01574 (M22-N187) (Accession)
Molecular Weight
Approximately 23 kDa
References & Citations
[1]Kuo PC, et al. Interferon-β Modulates Inflammatory Response in Cerebral Ischemia. J Am Heart Assoc. 2016 Jan 8;5 (1) .|[2]Sega S, et al. IFN-beta1a and IFN-beta1b have different patterns of influence on cytokines. Clin Neurol Neurosurg. 2004 Jun;106 (3) :255-8.|[3]Ivan Fan-Ngai Hung, et al.Triple Combination of Interferon beta-1b, Lopinavir-Ritonavir, and Ribavirin in the Treatment of Patients Admitted to Hospital With COVID-19: An Open-Label, Randomised, Phase 2 Trial. Lancet. 2020 May 30;395 (10238) :1695-1704.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog