Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-beta, Human (HEK293)

IFN-beta Protein, Human (HEK293) is a cytokine with immunomodulatory properties.IFN-beta Protein, Human (HEK293) can be used for the study of severe COVID-19 (coronavirus disease), it reduce viral load and improve lung pathology in a marmoset model[3].

Product Specifications

Product Name Alternative

IFN-beta Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-beta-protein-human-hek293.html

Purity

95.00

Smiles

MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

Molecular Formula

3456 (Gene_ID) P01574 (M22-N187) (Accession)

Molecular Weight

Approximately 23 kDa

References & Citations

[1]Kuo PC, et al. Interferon-β Modulates Inflammatory Response in Cerebral Ischemia. J Am Heart Assoc. 2016 Jan 8;5 (1) .|[2]Sega S, et al. IFN-beta1a and IFN-beta1b have different patterns of influence on cytokines. Clin Neurol Neurosurg. 2004 Jun;106 (3) :255-8.|[3]Ivan Fan-Ngai Hung, et al.Triple Combination of Interferon beta-1b, Lopinavir-Ritonavir, and Ribavirin in the Treatment of Patients Admitted to Hospital With COVID-19: An Open-Label, Randomised, Phase 2 Trial. Lancet. 2020 May 30;395 (10238) :1695-1704.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LONRF1 (NM_152271) Human Tagged Lenti ORF Clone
RC213130L4 10 µg

LONRF1 (NM_152271) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Porcine E1/ubiquitin-activating enzyme ELISA Kit
MBS746500-01 48 Well

Porcine E1/ubiquitin-activating enzyme ELISA Kit

Sign In for Pricing
View Details
Porcine E1/ubiquitin-activating enzyme ELISA Kit
MBS746500-02 96 Well

Porcine E1/ubiquitin-activating enzyme ELISA Kit

Sign In for Pricing
View Details
Porcine E1/ubiquitin-activating enzyme ELISA Kit
MBS746500-03 5x 96 Well

Porcine E1/ubiquitin-activating enzyme ELISA Kit

Sign In for Pricing
View Details
Porcine E1/ubiquitin-activating enzyme ELISA Kit
MBS746500-04 10x 96 Well

Porcine E1/ubiquitin-activating enzyme ELISA Kit

Sign In for Pricing
View Details
Pranlukast-d4
FP184048-01 2 mg

Pranlukast-d4

Sign In for Pricing
View Details