Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human IL8 Protein

Recombinant Human IL8 Protein is produced by E. coli expression system and the target gene encoding Glu31-Glu90 is expressed with a 6His tag at the C-terminus.

Product Specifications

Structure Composition

ELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVE

Product Name Alternative

CXCL8; Interleukin-8; IL-8; C-X-C motif chemokine 8; Emoctakin; Granulocyte chemotactic protein 1; GCP-1; Monocyte-derived neutrophil chemotactic factor; MDNCF; Monocyte-derived neutrophil-activating peptide; MONAP; Neutrophil-activating protein 1; NAP-1; Protein 3-10C; T-cell chemotactic factor

Reactivity

H

Source

E. coli

Applications

E, WB, SDS-PAGE, MS

Purity

Greater than 95% as determined by RP-HPLC and reducing SDS-PAGE.

Form

Liquid in a 0.2 μm filtered solution of PBS, pH 7.4.

Storage Conditions

Store it at -20°C to -80°C for one year. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

NCBI Gene Symbol

IL8

SwissProt (Human)

P10145

Entrez GeneHuman

3576

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MKI67 antibody
orb254644-01 50 μL

MKI67 antibody

Sign In for Pricing
View Details
MKI67 antibody
orb254644-02 100 µL

MKI67 antibody

Sign In for Pricing
View Details
Human 2'-5'-oligoadenylate synthase 3 ELISA Kit
orb1675481 96 Tests

Human 2'-5'-oligoadenylate synthase 3 ELISA Kit

Sign In for Pricing
View Details
Mouse C5a (Complement Component 5a) ELISA Kit
ELK1052-01 48 Tests

Mouse C5a (Complement Component 5a) ELISA Kit

Sign In for Pricing
View Details
Mouse C5a (Complement Component 5a) ELISA Kit
ELK1052-02 96 Tests

Mouse C5a (Complement Component 5a) ELISA Kit

Sign In for Pricing
View Details
Mouse C5a (Complement Component 5a) ELISA Kit
ELK1052-03 5x 96 Tests

Mouse C5a (Complement Component 5a) ELISA Kit

Sign In for Pricing
View Details