Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human COL3A1 Protein

Recombinant Human COL3A1 Protein is produced by Komagataella phaffii expression system and the target gene encoding double A908-A1136 is expressed with a 6His tag at the C-terminus.

Product Specifications

Structure Composition

AGNTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGPLGIAGITGARGLAGPPGMPGPRGSPGPQGVKGESGKPGANGLSGERGPPGPQGLPGLAGTAGEPGRDGNPGSDGLPGRDGSPGGKGDRGENGSPGAPGAPGHPGPPGPVGPAGKSGDRGESGPAGPAGAPGPAGSRGAPGPQGPRGDKGETGERGAAGIKGHRGFPGNPGAPGSPGPAGQQGAIGSPGPAGPRGPVGPSGPPGKDGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAAGNTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGPLGIAGITGARGLAGPPGMPGPRGSPGPQGVKGESGKPGANGLSGERGPPGPQGLPGLAGTAGEPGRDGNPGSDGLPGRDGSPGGKGDRGENGSPGAPGAPGHPGPPGPVGPAGKSGDRGESGPAGPAGAPGPAGSRGAPGPQGPRGDKGETGERGAAGIKGHRGFPGNPGAPGSPGPAGQQGAIGSPGPAGPRGPVGPSGPPGKDGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAHHHHHH

Product Name Alternative

Collagen alpha-1 (III) chain

Reactivity

H

Source

Komagataella phaffii

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Form

Lyophilized powder

Storage Conditions

Store it at -20°C to -80°C for two years. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

NCBI Gene Symbol

COL3A1

Quality Control

Endotoxin: Less than 0.05 EU/mg as determined by LAL test.

SwissProt (Human)

P02461

Entrez GeneHuman

1281

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Yme1l1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7070704 1.0 µg DNA

Yme1l1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
LONRF3 Double Nickase Plasmid (m2)
sc-428857-NIC-2 20 µg

LONRF3 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Rabbit Polyclonal CLN8 Antibody [mFluor Violet 450 SE]
NBP2-99467MFV450 0.1 mL

Rabbit Polyclonal CLN8 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Recombinant Mouse CD70 Protein, N-His
MBS1578392-01 0.1 mg

Recombinant Mouse CD70 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse CD70 Protein, N-His
MBS1578392-02 1 mg

Recombinant Mouse CD70 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse CD70 Protein, N-His
MBS1578392-03 5x 1 mg

Recombinant Mouse CD70 Protein, N-His

Sign In for Pricing
View Details