Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TARC/CCL17, Human (HEK293, His)

TARC/CCL17 Protein, Human (HEK293, His) is the first CC chemokine identified to interact with T cells with high affinity and bind to the CCR4 receptor to mediate inflammation, cancer, and autoimmune related diseases. TARC/CCL17 Protein, Human (HEK293, His) is a recombinant human TARC/CCL17 (A24-S94) protein expressed by HEK293 with a his tag at C end[1][2].

Product Specifications

Product Name Alternative

TARC/CCL17 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tarc-ccl17-protein-human-hek293-his.html

Purity

98.0

Smiles

ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERSHHHHHH

Molecular Formula

6361 (Gene_ID) Q92583 (A24-S94) (Accession)

Molecular Weight

Approximately 10-13 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Stefanie Scheu, et al. The C-C Chemokines CCL17 and CCL22 and Their Receptor CCR4 in CNS Autoimmunity. Int J Mol Sci. 2017 Nov 2;18 (11) :2306.|[2]Kashif Rasheed, et al. CCL17/TARC and CCR4 expression in Merkel cell carcinoma. Oncotarget. 2018 Jul 31;9 (59) :31432-31447.|[3]Julien Catherine, et al. What does elevated TARC/CCL17 expression tell us about eosinophilic disorders? Semin Immunopathol. 2021 Jun;43 (3) :439-458.|[4]Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21 (21) :8412.|[5]Yoshiki Mizukami, et al. CCL17 and CCL22 chemokines within tumor microenvironment are related to accumulation of Foxp3+ regulatory T cells in gastric cancer. Int J Cancer. 2008 May 15;122 (10) :2286-93.|[6]Amr A Al-haidari, et al. CCR4 mediates CCL17 (TARC) -induced migration of human colon cancer cells via RhoA/Rho-kinase signaling. Int J Colorectal Dis. 2013 Nov;28 (11) :1479-87.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal NUT Antibody (2B6) [mFluor Violet 500 SE]
NBP2-31147MFV500 0.1 mL

Mouse Monoclonal NUT Antibody (2B6) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Lentiviral human CYP4A22 sgRNA gene knockout kit - Lentiviral human CYP4A22 sgRNA gene knockout kit (25)
GTR15392628 1 Vial

Lentiviral human CYP4A22 sgRNA gene knockout kit - Lentiviral human CYP4A22 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
OR1AA1P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
34984061 1.0 µg DNA

OR1AA1P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
4-Benzylphenol
sc-226498 25 g

4-Benzylphenol

Sign In for Pricing
View Details
1,5-Dibromo-3-chloro-2- (phenylmethoxy) benzene
OR1098645 1 Each

1,5-Dibromo-3-chloro-2- (phenylmethoxy) benzene

Sign In for Pricing
View Details
ZNF263 Antibody (Center) Blocking Peptide
MBS9221888-01 0.5 mg

ZNF263 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details