Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL-R3 (human) polyclonal antibody

Product Specifications

Product Name Alternative

TRAIL receptor 3, DcR1, Death Receptor 1, TRID, CD263, TNFRSF 10C, TNF-related apoptosis-inducing ligand receptor 3, Tumor necrosis factor receptor superfamily member 10C

Certification

RUO

Gene ID

8794 (Entrez GeneID)

UniProt

O14798

Host

Goat

Species Reactivity

Human

Immunogen

Synthetic peptide corresponding to aa 33-63 (E33VPQQTVAPQQQRHSFKGEECPAGSHRSEHT63) of the extracellular domain of human TRAIL-R3.

Applications

Flow Cytometry, ICC, IHC (PS), WB

Purification

Epitope-affinity purified IgG.

Dilution

Flow Cytometry (1μl/106 cells/100μl) Immunocytochemistry (1:300), Western Blot (1:1,000) Suggested dilutions/conditions may not be available for all applications.Optimal conditions must be determined individually for each application.

Shipping Conditions

Blue Ice

Storage Conditions

-20°C

Formulation

Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.

Applications Notes

Detects a band of ~33kDa by Western blot.

Warranty

This antibody is covered by our Worry-Free Guarantee .

Quality Control

Western blot or Immunocytochemistry on cell lines HEK 293 or Jurkat.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Tryptase gamma-1/TPSG1 Antibody (OTI1G1) - Azide and BSA Free
NBP2-74652 100 µg

Mouse Monoclonal Tryptase gamma-1/TPSG1 Antibody (OTI1G1) - Azide and BSA Free

Sign In for Pricing
View Details
VEGFB protein, Human, Recombinant (His)
E51P90566 20 µg

VEGFB protein, Human, Recombinant (His)

Sign In for Pricing
View Details
Tissue Inhibitor of Metalloproteinases 2 (TIMP2)
T5585-10A 500 µL

Tissue Inhibitor of Metalloproteinases 2 (TIMP2)

Sign In for Pricing
View Details
Mouse Gm5128 qPCR Primer Pair
QM71798S 200 Tests

Mouse Gm5128 qPCR Primer Pair

Sign In for Pricing
View Details
PRP4 (Serine/Threonine-protein Kinase PRP4 Homolog, PRP4 pre-mRNA Processing Factor 4 Homolog, PRP4 Kinase, PRPF4B, KIAA0536, PRP4H, PRP4K) (PE)
MBS6159674-01 0.1 mL

PRP4 (Serine/Threonine-protein Kinase PRP4 Homolog, PRP4 pre-mRNA Processing Factor 4 Homolog, PRP4 Kinase, PRPF4B, KIAA0536, PRP4H, PRP4K) (PE)

Sign In for Pricing
View Details
PRP4 (Serine/Threonine-protein Kinase PRP4 Homolog, PRP4 pre-mRNA Processing Factor 4 Homolog, PRP4 Kinase, PRPF4B, KIAA0536, PRP4H, PRP4K) (PE)
MBS6159674-02 5x 0.1 mL

PRP4 (Serine/Threonine-protein Kinase PRP4 Homolog, PRP4 pre-mRNA Processing Factor 4 Homolog, PRP4 Kinase, PRPF4B, KIAA0536, PRP4H, PRP4K) (PE)

Sign In for Pricing
View Details