Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL-R3 (human) polyclonal antibody

Product Specifications

Product Name Alternative

TRAIL receptor 3, DcR1, Death Receptor 1, TRID, CD263, TNFRSF 10C, TNF-related apoptosis-inducing ligand receptor 3, Tumor necrosis factor receptor superfamily member 10C

Certification

RUO

Gene ID

8794 (Entrez GeneID)

UniProt

O14798

Host

Goat

Species Reactivity

Human

Immunogen

Synthetic peptide corresponding to aa 33-63 (E33VPQQTVAPQQQRHSFKGEECPAGSHRSEHT63) of the extracellular domain of human TRAIL-R3.

Applications

Flow Cytometry, ICC, IHC (PS), WB

Purification

Epitope-affinity purified IgG.

Dilution

Flow Cytometry (1μl/106 cells/100μl) Immunocytochemistry (1:300), Western Blot (1:1,000) Suggested dilutions/conditions may not be available for all applications.Optimal conditions must be determined individually for each application.

Shipping Conditions

Blue Ice

Storage Conditions

-20°C

Formulation

Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.

Applications Notes

Detects a band of ~33kDa by Western blot.

Warranty

This antibody is covered by our Worry-Free Guarantee .

Quality Control

Western blot or Immunocytochemistry on cell lines HEK 293 or Jurkat.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP-Cy5.5 Anti-Mouse CD40 Antibody (FGK4.5/FGK45)
PCP55-30021U-01 25 µg

PerCP-Cy5.5 Anti-Mouse CD40 Antibody (FGK4.5/FGK45)

Sign In for Pricing
View Details
PerCP-Cy5.5 Anti-Mouse CD40 Antibody (FGK4.5/FGK45)
PCP55-30021U-02 100 µg

PerCP-Cy5.5 Anti-Mouse CD40 Antibody (FGK4.5/FGK45)

Sign In for Pricing
View Details
PAOX (NM_207128) Human Mass Spec Standard
PH324235 10 µg

PAOX (NM_207128) Human Mass Spec Standard

Sign In for Pricing
View Details
Lentiviral mouse Rps17 shRNA (UAS) - Lentiviral mouse Rps17 shRNA (UAS, iRFP) (100)
GTR15117243 1 Vial

Lentiviral mouse Rps17 shRNA (UAS) - Lentiviral mouse Rps17 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
ECE1 (Endothelin Converting Enzyme 1, ECE) (MaxLight 750)
MBS6414922-01 0.1 mL

ECE1 (Endothelin Converting Enzyme 1, ECE) (MaxLight 750)

Sign In for Pricing
View Details
ECE1 (Endothelin Converting Enzyme 1, ECE) (MaxLight 750)
MBS6414922-02 5x 0.1 mL

ECE1 (Endothelin Converting Enzyme 1, ECE) (MaxLight 750)

Sign In for Pricing
View Details