Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active)

Product Specifications

Product Name Alternative

Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor (bFGF) ; Heparin-binding growth factor 2 (HBGF-2) ; Kidney-derived growth factor; FGF2

Abbreviation

Recombinant Bovine FGF2 protein (Active)

Gene Name

FGF2

UniProt

P03969

Expression Region

10-155aa

Organism

Bos taurus (Bovine)

Target Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of NIH-3T3 cells is 0.9252-2.630 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.5 kDa

References & Citations

Cell Density-Dependent Fibroblast Growth Factor-2 Signaling Regulates Syndecan-4 Expression in Cultured Vascular Endothelial Cells. Hara T., Yabushita S., Yamamoto C., Kaji T. Int J Mol Sci 21:E3698-E3698 (2020)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MICA Recombinant Rabbit monoclonal Antibody
HA723329B 100 µL

Human MICA Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Endosulfan (Mixture of Diastereomers)
TRC-E555505-1G 1 g

Endosulfan (Mixture of Diastereomers)

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09832R-01 20 Tests

Elab Fluor® Violet 500 Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09832R-02 100 Tests

Elab Fluor® Violet 500 Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09832R-03 2x 100 Tests

Elab Fluor® Violet 500 Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
TARM1 (NM_001135686) Human Over-expression Lysate
LC427668 20 µg

TARM1 (NM_001135686) Human Over-expression Lysate

Sign In for Pricing
View Details