Question 1

What is the catalog number for GP Antibody (HRP)?

Accepted Answer

The catalog number for GP Antibody (HRP) is orb27870.

Question 2

What sizes are available for GP Antibody (HRP)?

Accepted Answer

GP Antibody (HRP) is available in the following size(s): 50 µg, 100 µg.

Question 3

How many pack sizes does GP Antibody (HRP) come in?

Accepted Answer

GP Antibody (HRP) is available in 2 different pack sizes.

Question 4

Is GP Antibody (HRP) in stock?

Accepted Answer

GP Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

Question 5

What is GP Antibody (HRP) used for?

Accepted Answer

This GP Antibody, HRP conjugated is an HRP polyclonal product. It tagets GP using a Recombinant Zaire ebolavirus Envelope glycoprotein (502-637AA) as the immunogen. This antibody is suitable for ELISA. Purification: >95%, Protein G purified.

Question 6

Is this product suitable for live cell imaging?

Accepted Answer

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Question 7

Is this product covered by a money-back guarantee?

Accepted Answer

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Question 8

Can this product be used for diagnostic or therapeutic purposes?

Accepted Answer

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

GP Antibody (HRP)

Product Specifications

Product Name Alternative

UniProt

Reactivity

Immunogen

Target

Clonality

Conjugation

Field of Research

Purification

Dilution

Form

Storage Conditions

Notes

Tested Applications

Host or Source

Preservative

Isotype

Available Sizes

Frequently Asked Questions

Explore Other Products

CXorf40A (HRP)

CXorf40A (HRP)

Recombinant Escherichia coli Colicin-Ia (cia) (626:I→I-GFTFSNYAMSWVRQAPGKGLEWVSSQQYNSYPYT)

Recombinant Escherichia coli Colicin-Ia (cia) (626:I→I-GFTFSNYAMSWVRQAPGKGLEWVSSQQYNSYPYT)

Recombinant Escherichia coli Colicin-Ia (cia) (626:I→I-GFTFSNYAMSWVRQAPGKGLEWVSSQQYNSYPYT)

IL15 (Interleukin 15, Interleukin-15, IL-15, MGC9721) (FITC)