Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli O6:H1 DNA-binding protein HU-alpha (hupA)

Product Specifications

Product Name Alternative

HU-2; NS2

Abbreviation

Recombinant E.coli O6:H1 hupA protein

Gene Name

HupA

UniProt

P0ACF1

Expression Region

1-90aa

Organism

Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Target Sequence

MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

11.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anthrax toxin receptor 2 / ANTXR2 (32-318, His-tag) Mouse Protein
AR52052PU-S 20 µg

Anthrax toxin receptor 2 / ANTXR2 (32-318, His-tag) Mouse Protein

Sign In for Pricing
View Details
FUNDC2P siRNA Oligos set (Human)
57730171 3x 5 nmol

FUNDC2P siRNA Oligos set (Human)

Sign In for Pricing
View Details
Falcon Round Bottom Polypropylene Tube 14ml Without Cap 125 per bag
352018 1000 / PCK

Falcon Round Bottom Polypropylene Tube 14ml Without Cap 125 per bag

Sign In for Pricing
View Details
Rat Arid3b Pre-designed siRNA Set A
SI200903A 1 Each

Rat Arid3b Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human RHOT1 qPCR Primer Pair
QH44697S 200 Tests

Human RHOT1 qPCR Primer Pair

Sign In for Pricing
View Details
Human PYDC2 Protein Lysate
MBS8418124-01 0.02 mg

Human PYDC2 Protein Lysate

Sign In for Pricing
View Details