Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat C-X-C motif chemokine 3 protein (Cxcl3) (Active)

Product Specifications

Product Name Alternative

Cytokine-induced neutrophil chemoattractant 2, Macrophage inflammatory protein 2-alpha/beta, MIP2-alpha/beta

Abbreviation

Recombinant Rat Cinc2 protein (Active)

Gene Name

Cxcl3

UniProt

Q10746

Expression Region

33-101aa

Organism

Rattus norvegicus (Rat)

Target Sequence

RELRCQCLKTLPRVDFENIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSDKSS

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Ligand for CXCR2 (By similarity) . Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. {ECO:0000250, ECO:0000269|PubMed:8043001, ECO:0000269|PubMed:8607872}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>96% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CXCR2 transfected murine BaF3 cells is in a concentration range of 5-50 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 50 mM NaCl

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Ligand for CXCR2 (By similarity) . Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.

Molecular Weight

7.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAZ (tafazzin, BTHS, CMD3A, EFE, EFE2, FLJ27390, G4.5, LVNCX, Taz1, XAP-2) (MaxLight 650)
252397-ML650 100 µL

TAZ (tafazzin, BTHS, CMD3A, EFE, EFE2, FLJ27390, G4.5, LVNCX, Taz1, XAP-2) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Human LTBR/ TNFRSF3 Protein, His, E.coli-10ug
QP8595-ec-10ug 10ug

Recombinant Human LTBR/ TNFRSF3 Protein, His, E.coli-10ug

Sign In for Pricing
View Details
Agpat1 Rat shRNA Lentiviral Particle (Locus ID 406165)
TL713891V 500 µL Each

Agpat1 Rat shRNA Lentiviral Particle (Locus ID 406165)

Sign In for Pricing
View Details
STAT5B (Signal Transducer and Activator of Transcription 5B, Signal Transducer and Activator of Transcription 5, STAT5) (AP)
MBS6439256-01 0.1 mL

STAT5B (Signal Transducer and Activator of Transcription 5B, Signal Transducer and Activator of Transcription 5, STAT5) (AP)

Sign In for Pricing
View Details
STAT5B (Signal Transducer and Activator of Transcription 5B, Signal Transducer and Activator of Transcription 5, STAT5) (AP)
MBS6439256-02 5x 0.1 mL

STAT5B (Signal Transducer and Activator of Transcription 5B, Signal Transducer and Activator of Transcription 5, STAT5) (AP)

Sign In for Pricing
View Details
Mouse Monoclonal GAD1/GAD67 Antibody (GAD1/2391) [Alexa Fluor 647]
NBP3-08276AF647 100 µL

Mouse Monoclonal GAD1/GAD67 Antibody (GAD1/2391) [Alexa Fluor 647]

Sign In for Pricing
View Details