Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma pneumoniae Mgp-operon protein 3, partial

Product Specifications

Product Name Alternative

ORF-3 protein

Abbreviation

Recombinant Mycoplasma pneumoniae Mgp-operon protein 3, partial

UniProt

Q50341

Expression Region

487-718aa

Organism

Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Target Sequence

IVVMGSDRVPSLWYWVVGEDQESGKATWWAKTELNWGTDKQKQFVENQLGFKDDSNSDSKNSNLKAQGLTQPAYLIAGLDVVADHLVFAAFKAGAVGYDMTTDSSASTYNQALAWSTTAGLDSDGGYKALVENTAGLNGPINGLFTLLDTFAYVTPVSGMKGGSQNNEEVQTTYPVKSDQKATAKIASLINASPLNSYGDDGVTVFDALGLNFNFKLNEERLPSRTDQLLVY

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (rDG1/447), CF594 conjugate, 0.1mg/mL
BNC941869-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (rDG1/447), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UAP1 (NM_003115) Human Over-expression Lysate
LY418892 100 µg

UAP1 (NM_003115) Human Over-expression Lysate

Sign In for Pricing
View Details
CATIP Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A6]
TA505507AM 100 µL

CATIP Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A6]

Sign In for Pricing
View Details
Rat Interleukin 20 (IL20) ELISA Kit
RDR-IL20-Ra-01 96 Tests

Rat Interleukin 20 (IL20) ELISA Kit

Sign In for Pricing
View Details
Rat Interleukin 20 (IL20) ELISA Kit
RDR-IL20-Ra-02 48 Tests

Rat Interleukin 20 (IL20) ELISA Kit

Sign In for Pricing
View Details
CYP24A1 (C-term) Rabbit Polyclonal Antibody
AP17963PU-N 400 µL

CYP24A1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details