Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement C3 (C3), partial

Product Specifications

Product Name Alternative

C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1

Abbreviation

Recombinant Human C3 protein, partial

Gene Name

C3

UniProt

P01024

Expression Region

26-225aa

Organism

Homo sapiens (Human)

Target Sequence

YSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

C3 plays a central role in the activation of the complent syst. Its processing by C3 convertase is the central reaction in both classical and alternative complent pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.Derived from proteolytic degradation of complent C3, C3a anaphylatoxin is a mediator of local inflammatory process. In chronic inflammation, acts as a choattractant for neutrophils . It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes.C3-beta-c: Acts as a choattractant for neutrophils in chronic inflammation.Acylation stimulating protein: adipogenic hormone that stimulates triglyceride (TG) synthesis and glucose transport in adipocytes, regulating fat storage and playing a role in postprandial TG clearance. Appears to stimulate TG synthesis via activation of the PLC, MAPK and AKT signaling pathways. Ligand for C5AR2. Promotes the phosphorylation, ARRB2-mediated internalization and recycling of C5AR2

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.; FUNCTION

Molecular Weight

26.4 kDa

References & Citations

Human complement component C3 cDNA coding sequence and derived primary structure.de Bruijn M.H.L., Fey G.H.Proc. Natl. Acad. Sci. U.S.A. 82:708-712 (1985)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12549927/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NM23A (NME1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI21H5]
TA801521BM 100 µL

NM23A (NME1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI21H5]

Ask
View Details
Anti-RGS10 Antibody
A05197-2 100 µL

Anti-RGS10 Antibody

Ask
View Details
Rabbit Anti-CKAP4 antibody
SL6520R-01 50 µL

Rabbit Anti-CKAP4 antibody

Ask
View Details
Rabbit Anti-CKAP4 antibody
SL6520R-02 100 µL

Rabbit Anti-CKAP4 antibody

Ask
View Details
Rabbit Uracil Phosphoribosyltransferase ELISA Kit
MBS103182 Inquire

Rabbit Uracil Phosphoribosyltransferase ELISA Kit

Ask
View Details
Mouse Monoclonal Cathepsin Z Antibody (05) [DyLight 550]
NBP3-26880R 0.1 mL

Mouse Monoclonal Cathepsin Z Antibody (05) [DyLight 550]

Ask
View Details