IL-17A, Mouse (E. coli)
IL-17A protein is an important effector cytokine that activates the NF-kappa-B and MAPkinase pathways through the IL17RA-IL17RC receptor complex to protect host tissues from microbial threats. As a key Th17 cytokine, IL-17A mediates neutrophil activation, chemotaxis, and contributes to germinal center formation. IL-17A Protein, Mouse (E. coli) is the recombinant mouse-derived IL-17A protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
IL-17A Protein, Mouse (E. coli), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-17a-protein-mouse-e-coli.html
Purity
97
Smiles
TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
Molecular Formula
16171 (Gene_ID) Q62386 (T22-A158) (Accession)
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
PEBP4, ID (PEBP4, CORK1, Phosphatidylethanolamine-binding protein 4, Protein cousin-of-RKIP 1) (FITC)
PEBP4, ID (PEBP4, CORK1, Phosphatidylethanolamine-binding protein 4, Protein cousin-of-RKIP 1) (FITC)
Lentiviral human ZNF699 sgRNA gene knockout kit - Lentiviral human ZNF699 sgRNA gene knockout kit (25)
IL2 (Interleukin-2, IL-2, T-cell Growth Factor, TCGF, Aldesleukin) (MaxLight 750)
IL2 (Interleukin-2, IL-2, T-cell Growth Factor, TCGF, Aldesleukin) (MaxLight 750)
