Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha-crystallin A chain/CRYAA, Human (His)

Alpha-crystallin A chain/CRYAA Protein, Human (His) is a recombinant Alpha-crystallin A chain protein with a His tag. Alpha-crystallin A chain/CRYAA is a small heat shock protein and molecular chaperone that prevents nonspecific aggregation of denaturing proteins. Several point mutations in the alphaA-crystallin gene cause congenital human cataracts by unknown mechanisms[1].

Product Specifications

Product Name Alternative

Alpha-crystallin A chain/CRYAA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-crystallin-a-chain-cryaa-protein-human-his.html

Purity

96.30

Smiles

MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS

Molecular Formula

1409 (Gene_ID) P02489 (M1-S173) (Accession)

Molecular Weight

Approximately 20-23 kDa

References & Citations

[1]Xi JH, et al. Mechanism of small heat shock protein function in vivo: a knock-in mouse model demonstrates that the R49C mutation in alpha A-crystallin enhances protein insolubility and cell death. J Biol Chem. 2008;283 (9) :5801-5814.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Snx8 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4704002 1.0 µg DNA

Snx8 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Recombinant Human METAP2 Protein, His-tagged
MK0558H 10 µg

Recombinant Human METAP2 Protein, His-tagged

Sign In for Pricing
View Details
ANXA8L2 cDNA Clone
MBS1276347-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

ANXA8L2 cDNA Clone

Sign In for Pricing
View Details
ANXA8L2 cDNA Clone
MBS1276347-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

ANXA8L2 cDNA Clone

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O139:H28 (strain E24377A/ETEC) MDH Polyclonal Antibody
MBS7140195 Inquire

Rabbit anti-Escherichia coli O139:H28 (strain E24377A/ETEC) MDH Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CST7 (C-6His)
PHH0498-01 10 µg

Recombinant Human CST7 (C-6His)

Sign In for Pricing
View Details