Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha-crystallin A chain/CRYAA, Human (His)

Alpha-crystallin A chain/CRYAA Protein, Human (His) is a recombinant Alpha-crystallin A chain protein with a His tag. Alpha-crystallin A chain/CRYAA is a small heat shock protein and molecular chaperone that prevents nonspecific aggregation of denaturing proteins. Several point mutations in the alphaA-crystallin gene cause congenital human cataracts by unknown mechanisms[1].

Product Specifications

Product Name Alternative

Alpha-crystallin A chain/CRYAA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-crystallin-a-chain-cryaa-protein-human-his.html

Purity

96.30

Smiles

MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS

Molecular Formula

1409 (Gene_ID) P02489 (M1-S173) (Accession)

Molecular Weight

Approximately 20-23 kDa

References & Citations

[1]Xi JH, et al. Mechanism of small heat shock protein function in vivo: a knock-in mouse model demonstrates that the R49C mutation in alpha A-crystallin enhances protein insolubility and cell death. J Biol Chem. 2008;283 (9) :5801-5814.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLA2G2A (Phospholipase A2, Membrane Associated, Phospholipase A2, Group IIA, MOM1, PLA2, PLA2B, PLA2L, PLA2S, PLAS1, sPLA2) (Biotin)
MBS6431833-01 0.1 mL

PLA2G2A (Phospholipase A2, Membrane Associated, Phospholipase A2, Group IIA, MOM1, PLA2, PLA2B, PLA2L, PLA2S, PLAS1, sPLA2) (Biotin)

Sign In for Pricing
View Details
PLA2G2A (Phospholipase A2, Membrane Associated, Phospholipase A2, Group IIA, MOM1, PLA2, PLA2B, PLA2L, PLA2S, PLAS1, sPLA2) (Biotin)
MBS6431833-02 5x 0.1 mL

PLA2G2A (Phospholipase A2, Membrane Associated, Phospholipase A2, Group IIA, MOM1, PLA2, PLA2B, PLA2L, PLA2S, PLAS1, sPLA2) (Biotin)

Sign In for Pricing
View Details
2x Cell Freezing Medium
TBS8018 50 mL

2x Cell Freezing Medium

Sign In for Pricing
View Details
Recombinant Burkholderia phytofirmans Membrane protein insertase YidC (yidC), partial
MBS7066748 Inquire

Recombinant Burkholderia phytofirmans Membrane protein insertase YidC (yidC), partial

Sign In for Pricing
View Details
MAGI3 (Membrane-Associated Guanylate Kinase, WW and PDZ Domain-Containing Protein 3, Membrane-Associated Guanylate Kinase inverted 3, MAGI-3, MAGI3, KIAA1634) (HRP) discontinued
302544-HRP 100 µL

MAGI3 (Membrane-Associated Guanylate Kinase, WW and PDZ Domain-Containing Protein 3, Membrane-Associated Guanylate Kinase inverted 3, MAGI-3, MAGI3, KIAA1634) (HRP) discontinued

Sign In for Pricing
View Details
WNT3A (Wingless-type MMTV Integration Site Family Member 3A, Protein Wnt-3a) (MaxLight 650)
MBS6398598-01 0.1 mL

WNT3A (Wingless-type MMTV Integration Site Family Member 3A, Protein Wnt-3a) (MaxLight 650)

Sign In for Pricing
View Details