Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha-crystallin A chain/CRYAA, Human (His)

Alpha-crystallin A chain/CRYAA Protein, Human (His) is a recombinant Alpha-crystallin A chain protein with a His tag. Alpha-crystallin A chain/CRYAA is a small heat shock protein and molecular chaperone that prevents nonspecific aggregation of denaturing proteins. Several point mutations in the alphaA-crystallin gene cause congenital human cataracts by unknown mechanisms[1].

Product Specifications

Product Name Alternative

Alpha-crystallin A chain/CRYAA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-crystallin-a-chain-cryaa-protein-human-his.html

Purity

96.30

Smiles

MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS

Molecular Formula

1409 (Gene_ID) P02489 (M1-S173) (Accession)

Molecular Weight

Approximately 20-23 kDa

References & Citations

[1]Xi JH, et al. Mechanism of small heat shock protein function in vivo: a knock-in mouse model demonstrates that the R49C mutation in alpha A-crystallin enhances protein insolubility and cell death. J Biol Chem. 2008;283 (9) :5801-5814.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLHL20 sgRNA CRISPR Lentivector (Human) (Target 1)
K1157802 1.0 µg DNA

KLHL20 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
IKK alpha (Inhibitor Of Nuclear Factor kappa-B Kinase alpha Subunit, I kappa-B Kinase alpha, IkBKA, IKK-A, IkappaB Kinase, I-kappa-B Kinase 1, IKK1, Conserved Helix-loop-Helix Ubiquitous Kinase, Nuclear Factor NFkappaB Inhibitor Kinase alpha, NFKBIKA, Transcription Factor 16, TCF-16, CHUK, IKKA, TCF16) (MaxLight 405) discontinued
128369-ML405 100 µL

IKK alpha (Inhibitor Of Nuclear Factor kappa-B Kinase alpha Subunit, I kappa-B Kinase alpha, IkBKA, IKK-A, IkappaB Kinase, I-kappa-B Kinase 1, IKK1, Conserved Helix-loop-Helix Ubiquitous Kinase, Nuclear Factor NFkappaB Inhibitor Kinase alpha, NFKBIKA, Transcription Factor 16, TCF-16, CHUK, IKKA, TCF16) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Human Semenogelin-2 (SEMG2) ELISA Kit
KTE60709-01 48 Tests

Human Semenogelin-2 (SEMG2) ELISA Kit

Sign In for Pricing
View Details
Human Semenogelin-2 (SEMG2) ELISA Kit
KTE60709-02 96 Tests

Human Semenogelin-2 (SEMG2) ELISA Kit

Sign In for Pricing
View Details
Human Semenogelin-2 (SEMG2) ELISA Kit
KTE60709-03 5x 96 Tests

Human Semenogelin-2 (SEMG2) ELISA Kit

Sign In for Pricing
View Details
Human Semenogelin-2 (SEMG2) ELISA Kit
KTE60709-04 50x 96 Tests

Human Semenogelin-2 (SEMG2) ELISA Kit

Sign In for Pricing
View Details