Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha-crystallin A chain/CRYAA, Human (His)

Alpha-crystallin A chain/CRYAA Protein, Human (His) is a recombinant Alpha-crystallin A chain protein with a His tag. Alpha-crystallin A chain/CRYAA is a small heat shock protein and molecular chaperone that prevents nonspecific aggregation of denaturing proteins. Several point mutations in the alphaA-crystallin gene cause congenital human cataracts by unknown mechanisms[1].

Product Specifications

Product Name Alternative

Alpha-crystallin A chain/CRYAA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-crystallin-a-chain-cryaa-protein-human-his.html

Purity

96.30

Smiles

MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS

Molecular Formula

1409 (Gene_ID) P02489 (M1-S173) (Accession)

Molecular Weight

Approximately 20-23 kDa

References & Citations

[1]Xi JH, et al. Mechanism of small heat shock protein function in vivo: a knock-in mouse model demonstrates that the R49C mutation in alpha A-crystallin enhances protein insolubility and cell death. J Biol Chem. 2008;283 (9) :5801-5814.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor IX (F9) Human shRNA Plasmid Kit (Locus ID 2158)
TR313110 1 Kit

Factor IX (F9) Human shRNA Plasmid Kit (Locus ID 2158)

Sign In for Pricing
View Details
LOC498971 ORF Vector (Rat) (pORF)
ORF069668 1.0 µg DNA

LOC498971 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
RHBDL2 (Rhomboid-like Protein 2, Rhomboid-related Protein 2, RRP2) (MaxLight 750) discontinued
132546-ML750 100 µL

RHBDL2 (Rhomboid-like Protein 2, Rhomboid-related Protein 2, RRP2) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Human ZNF124 qPCR Primer Pair
QH25137S 200 Tests

Human ZNF124 qPCR Primer Pair

Sign In for Pricing
View Details
STOM (Erythrocyte Band 7 Integral Membrane Protein, Protein 7.2b, Stomatin, BND7, EPB72) (AP)
MBS6395444-01 0.1 mL

STOM (Erythrocyte Band 7 Integral Membrane Protein, Protein 7.2b, Stomatin, BND7, EPB72) (AP)

Sign In for Pricing
View Details
STOM (Erythrocyte Band 7 Integral Membrane Protein, Protein 7.2b, Stomatin, BND7, EPB72) (AP)
MBS6395444-02 5x 0.1 mL

STOM (Erythrocyte Band 7 Integral Membrane Protein, Protein 7.2b, Stomatin, BND7, EPB72) (AP)

Sign In for Pricing
View Details