Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha-crystallin A chain/CRYAA, Human (His)

Alpha-crystallin A chain/CRYAA Protein, Human (His) is a recombinant Alpha-crystallin A chain protein with a His tag. Alpha-crystallin A chain/CRYAA is a small heat shock protein and molecular chaperone that prevents nonspecific aggregation of denaturing proteins. Several point mutations in the alphaA-crystallin gene cause congenital human cataracts by unknown mechanisms[1].

Product Specifications

Product Name Alternative

Alpha-crystallin A chain/CRYAA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-crystallin-a-chain-cryaa-protein-human-his.html

Purity

96.30

Smiles

MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS

Molecular Formula

1409 (Gene_ID) P02489 (M1-S173) (Accession)

Molecular Weight

Approximately 20-23 kDa

References & Citations

[1]Xi JH, et al. Mechanism of small heat shock protein function in vivo: a knock-in mouse model demonstrates that the R49C mutation in alpha A-crystallin enhances protein insolubility and cell death. J Biol Chem. 2008;283 (9) :5801-5814.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ochromycinone (Standard)
HY-18061R 1 Each

Ochromycinone (Standard)

Sign In for Pricing
View Details
Mouse Polyclonal Niban Antibody
H00116496-B01P 0.05 mg

Mouse Polyclonal Niban Antibody

Sign In for Pricing
View Details
TMEM194B Double Nickase Plasmid (h2)
sc-416214-NIC-2 20 µg

TMEM194B Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Donkey StAR-Related Lipid Transfer Protein 7, Mitochondrial (STARD7) ELISA Kit
MBS9924250 Inquire

Donkey StAR-Related Lipid Transfer Protein 7, Mitochondrial (STARD7) ELISA Kit

Sign In for Pricing
View Details
Plant Glucocorticoid Induced Tumor Necrosis Factor Receptor (GITR) ELISA Kit
MBS9374127 Inquire

Plant Glucocorticoid Induced Tumor Necrosis Factor Receptor (GITR) ELISA Kit

Sign In for Pricing
View Details
Human B cell lymphoma-XL (BCL-XL) ELISA kit
SL3663Hu-01 96 Tests

Human B cell lymphoma-XL (BCL-XL) ELISA kit

Sign In for Pricing
View Details