Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha-crystallin A chain/CRYAA, Human (His)

Alpha-crystallin A chain/CRYAA Protein, Human (His) is a recombinant Alpha-crystallin A chain protein with a His tag. Alpha-crystallin A chain/CRYAA is a small heat shock protein and molecular chaperone that prevents nonspecific aggregation of denaturing proteins. Several point mutations in the alphaA-crystallin gene cause congenital human cataracts by unknown mechanisms[1].

Product Specifications

Product Name Alternative

Alpha-crystallin A chain/CRYAA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-crystallin-a-chain-cryaa-protein-human-his.html

Purity

96.30

Smiles

MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS

Molecular Formula

1409 (Gene_ID) P02489 (M1-S173) (Accession)

Molecular Weight

Approximately 20-23 kDa

References & Citations

[1]Xi JH, et al. Mechanism of small heat shock protein function in vivo: a knock-in mouse model demonstrates that the R49C mutation in alpha A-crystallin enhances protein insolubility and cell death. J Biol Chem. 2008;283 (9) :5801-5814.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd226 3'UTR GFP Stable Cell Line
TU153475 1.0 mL

Cd226 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit IL8 (Interleukin 8) ELISA Kit
EK241925 96 Well

Rabbit IL8 (Interleukin 8) ELISA Kit

Sign In for Pricing
View Details
Cleaved-Lamin A (N231) rabbit pAb
ES6123-01 50 µL

Cleaved-Lamin A (N231) rabbit pAb

Sign In for Pricing
View Details
Cleaved-Lamin A (N231) rabbit pAb
ES6123-02 100 µL

Cleaved-Lamin A (N231) rabbit pAb

Sign In for Pricing
View Details
SNAR-E CRISPR Knock Out 293T Cell Line (Human)
44534141 1x 10^6 Cells / 1.0 mL

SNAR-E CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Retinoic acid-d3-1
HY-14649S6 1 Each

Retinoic acid-d3-1

Sign In for Pricing
View Details