Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha-crystallin A chain/CRYAA, Human (His)

Alpha-crystallin A chain/CRYAA Protein, Human (His) is a recombinant Alpha-crystallin A chain protein with a His tag. Alpha-crystallin A chain/CRYAA is a small heat shock protein and molecular chaperone that prevents nonspecific aggregation of denaturing proteins. Several point mutations in the alphaA-crystallin gene cause congenital human cataracts by unknown mechanisms[1].

Product Specifications

Product Name Alternative

Alpha-crystallin A chain/CRYAA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-crystallin-a-chain-cryaa-protein-human-his.html

Purity

96.30

Smiles

MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS

Molecular Formula

1409 (Gene_ID) P02489 (M1-S173) (Accession)

Molecular Weight

Approximately 20-23 kDa

References & Citations

[1]Xi JH, et al. Mechanism of small heat shock protein function in vivo: a knock-in mouse model demonstrates that the R49C mutation in alpha A-crystallin enhances protein insolubility and cell death. J Biol Chem. 2008;283 (9) :5801-5814.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Osimertinib Impurity 43
RM-O190943-01 10 mg

Osimertinib Impurity 43

Sign In for Pricing
View Details
Osimertinib Impurity 43
RM-O190943-02 100 mg

Osimertinib Impurity 43

Sign In for Pricing
View Details
Osimertinib Impurity 43
RM-O190943-03 25 mg

Osimertinib Impurity 43

Sign In for Pricing
View Details
Osimertinib Impurity 43
RM-O190943-04 50 mg

Osimertinib Impurity 43

Sign In for Pricing
View Details
Lentiviral human MMUT shRNA (UAS) - Lentiviral human MMUT shRNA (UAS) (100)
GTR15345129 1 Vial

Lentiviral human MMUT shRNA (UAS) - Lentiviral human MMUT shRNA (UAS) (100)

Sign In for Pricing
View Details
TTBK2 discontinued
515408 100 µg

TTBK2 discontinued

Sign In for Pricing
View Details