IL-1 beta, Human (E6K, His)
IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta Protein, Human (E6K, His) is produced in E. coli with a N-Terminal His-tag. It consists of 269 amino acids (M1-S269) .
Product Specifications
Product Name Alternative
IL-1 beta Protein, Human (E6K, His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-1-beta-protein-human-his.html
Purity
98.0
Smiles
MAEVPKLASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Molecular Formula
3553 (Gene_ID) P01584/NP_000567.1 (M1-S269, E6K) (Accession)
Molecular Weight
Approximately 32-34 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Jan Petrasek, et al. IL-1 receptor antagonist ameliorates inflammasome-dependent alcoholic steatohepatitis in mice. J Clin Invest. 2012 Oct;122 (10) :3476-89.|[2]Karina Zitta, et al. Interleukin-1beta regulates cell proliferation and activity of extracellular matrix remodelling enzymes in cultured primary pig heart cells. Biochem Biophys Res Commun. 2010 Sep 3;399 (4) :542-7.|[3]Kenichi Shimada, et al. Caspase-1 dependent IL-1β secretion is critical for host defense in a mouse model of Chlamydia pneumoniae lung infection. PLoS One. 2011;6 (6) :e21477.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K0754604 1.0 µg DNA
FAM178B sgRNA CRISPR Lentivector (Human) (Target 3)
Sign In for Pricing
View Details 
T9840 1x106 cells / 1.0 mL
HMGB1 (Human) shRNA Stable THP-1 Cell Line-Polyclone (Lenti-U6-shRNA-CMV-GFP-2A-Puro)
Sign In for Pricing
View Details sc-417576-LAC-2 200 µL
Myoneurin Lentiviral Activation Particles (h2)
Sign In for Pricing
View Details