Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha-hemolysin, S. aureus (P.pastoris, His)

Product Specifications

UNSPSC Description

The alpha-hemolysin protein binds to eukaryotic cell membranes, triggering the release of low molecular weight molecules and causing osmotic lysis. It inhibits the chemotaxis of host neutrophils toward the diseased area. Alpha-hemolysin Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Alpha-hemolysin protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Alpha-hemolysin Protein, S. aureus (P.pastoris, His) is 293 a.a., with molecular weight of ~35.3 kDa.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-hemolysin-protein-s-aureus-p-pastoris-his.html

Purity

98.0

Smiles

ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN

Molecular Weight

Approximately 35.3 kDa

Shipping Conditions

Blue Ice

Storage Conditions

Stored at -20°C for 2 years

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cefoperazone Dihydrate
TRC-C242905-5MG 5 mg

Cefoperazone Dihydrate

Sign In for Pricing
View Details
Infectious Peritonitis, Feline (FIPV) (AP) discontinued
I7600-51-AP 100 µL

Infectious Peritonitis, Feline (FIPV) (AP) discontinued

Sign In for Pricing
View Details
Cytokeratin 17 Recombinant Antibody, PE-Cy5 Conjugated
bsm-52057R-PE-Cy5-01 20 µL

Cytokeratin 17 Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Cytokeratin 17 Recombinant Antibody, PE-Cy5 Conjugated
bsm-52057R-PE-Cy5-02 100 µL

Cytokeratin 17 Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
PATL2, ID (PATL2, Protein PAT1 homolog 2, PAT1-like protein 2, Protein PAT1 homolog a) (AP) discontinued
039695-AP 200 µL

PATL2, ID (PATL2, Protein PAT1 homolog 2, PAT1-like protein 2, Protein PAT1 homolog a) (AP) discontinued

Sign In for Pricing
View Details
Recombinant Human Protein FAM181A (FAM181A)
MBS1415647-01 0.02 mg (E-Coli)

Recombinant Human Protein FAM181A (FAM181A)

Sign In for Pricing
View Details