Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha-hemolysin, S. aureus (P.pastoris, His)

Product Specifications

UNSPSC Description

The alpha-hemolysin protein binds to eukaryotic cell membranes, triggering the release of low molecular weight molecules and causing osmotic lysis. It inhibits the chemotaxis of host neutrophils toward the diseased area. Alpha-hemolysin Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Alpha-hemolysin protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Alpha-hemolysin Protein, S. aureus (P.pastoris, His) is 293 a.a., with molecular weight of ~35.3 kDa.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-hemolysin-protein-s-aureus-p-pastoris-his.html

Purity

98.0

Smiles

ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN

Molecular Weight

Approximately 35.3 kDa

Shipping Conditions

Blue Ice

Storage Conditions

Stored at -20°C for 2 years

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Fluoro-1,3-dioxolan-2-one-d3
TRC-F591528-10MG 10 mg

4-Fluoro-1,3-dioxolan-2-one-d3

Sign In for Pricing
View Details
Feline Leukemia Virus, p15E (FeLV) (FITC)
MBS6249877-01 0.1 mL

Feline Leukemia Virus, p15E (FeLV) (FITC)

Sign In for Pricing
View Details
Feline Leukemia Virus, p15E (FeLV) (FITC)
MBS6249877-02 5x 0.1 mL

Feline Leukemia Virus, p15E (FeLV) (FITC)

Sign In for Pricing
View Details
D- (-) -Ribose Plant Culture Tested
PCT0614-5G 5 g

D- (-) -Ribose Plant Culture Tested

Sign In for Pricing
View Details
ZAP-70 (PT2241) mouse mAb
MBS8537608-01 0.1 mL

ZAP-70 (PT2241) mouse mAb

Sign In for Pricing
View Details
ZAP-70 (PT2241) mouse mAb
MBS8537608-02 0.1 mL (AF635)

ZAP-70 (PT2241) mouse mAb

Sign In for Pricing
View Details