Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha-hemolysin, S. aureus (P.pastoris, His)

Product Specifications

UNSPSC Description

The alpha-hemolysin protein binds to eukaryotic cell membranes, triggering the release of low molecular weight molecules and causing osmotic lysis. It inhibits the chemotaxis of host neutrophils toward the diseased area. Alpha-hemolysin Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Alpha-hemolysin protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Alpha-hemolysin Protein, S. aureus (P.pastoris, His) is 293 a.a., with molecular weight of ~35.3 kDa.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-hemolysin-protein-s-aureus-p-pastoris-his.html

Purity

98.0

Smiles

ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN

Molecular Weight

Approximately 35.3 kDa

Shipping Conditions

Blue Ice

Storage Conditions

Stored at -20°C for 2 years

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-mmu-miR-463-5p Virus
mm1408 250 µL

AdmiRa-mmu-miR-463-5p Virus

Sign In for Pricing
View Details
Olr1253 3'UTR GFP Stable Cell Line
TU264578 1.0 mL

Olr1253 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PSPH, NT (PSPH, Phosphoserine phosphatase, L-3-phosphoserine phosphatase, O-phosphoserine phosphohydrolase) (MaxLight 405) discontinued
040578-ML405 100 µL

PSPH, NT (PSPH, Phosphoserine phosphatase, L-3-phosphoserine phosphatase, O-phosphoserine phosphohydrolase) (MaxLight 405) discontinued

Sign In for Pricing
View Details
FAME Std M cis-5-eicosenoate C20:1 10mg/mL in Hept - 1ML
REUFA019S 1 mL

FAME Std M cis-5-eicosenoate C20:1 10mg/mL in Hept - 1ML

Sign In for Pricing
View Details
Granzyme K antibody
70R-7379 50 ug

Granzyme K antibody

Sign In for Pricing
View Details
MVD (NM_002461) Human Recombinant Protein
TP300451L 1 mg

MVD (NM_002461) Human Recombinant Protein

Sign In for Pricing
View Details