Alpha-hemolysin, S. aureus (P.pastoris, His)

Product Specifications

UNSPSC Description

The alpha-hemolysin protein binds to eukaryotic cell membranes, triggering the release of low molecular weight molecules and causing osmotic lysis. It inhibits the chemotaxis of host neutrophils toward the diseased area. Alpha-hemolysin Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Alpha-hemolysin protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Alpha-hemolysin Protein, S. aureus (P.pastoris, His) is 293 a.a., with molecular weight of ~35.3 kDa.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-hemolysin-protein-s-aureus-p-pastoris-his.html

Purity

98.0

Smiles

ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN

Molecular Weight

Approximately 35.3 kDa

Shipping Conditions

Blue Ice

Storage Conditions

Stored at -20°C for 2 years

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

M3007-13-ML490 100 µL

C-Met, CT (Hepatocyte Growth Factor Receptor, Scatter Factor Receptor, HGFR, SFR) (MaxLight 490)

View Details

AGI1869-100 100 µL

KD-Validated Anti-LDL Receptor Related Protein 1 Rabbit Monoclonal Antibody

View Details

PT_74404-01 100 µg

Recombinant Dengue Virus Subtype 1 Envelope 32kDa, Suitable for Gold Conjugation

View Details

PT_74404-02 500 µg

Recombinant Dengue Virus Subtype 1 Envelope 32kDa, Suitable for Gold Conjugation

View Details

PT_74404-03 1 mg

Recombinant Dengue Virus Subtype 1 Envelope 32kDa, Suitable for Gold Conjugation

View Details

RC204385L4V 200 µL

Nucleotide binding protein like (NUBPL) (NM_025152) Human Tagged ORF Clone Lentiviral Particle

View Details