Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha-hemolysin, S. aureus (P.pastoris, His)

Product Specifications

UNSPSC Description

The alpha-hemolysin protein binds to eukaryotic cell membranes, triggering the release of low molecular weight molecules and causing osmotic lysis. It inhibits the chemotaxis of host neutrophils toward the diseased area. Alpha-hemolysin Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Alpha-hemolysin protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Alpha-hemolysin Protein, S. aureus (P.pastoris, His) is 293 a.a., with molecular weight of ~35.3 kDa.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-hemolysin-protein-s-aureus-p-pastoris-his.html

Purity

98.0

Smiles

ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN

Molecular Weight

Approximately 35.3 kDa

Shipping Conditions

Blue Ice

Storage Conditions

Stored at -20°C for 2 years

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bub3 Blocking Peptide
NBP1-76796PEP 0.05 mg

Bub3 Blocking Peptide

Sign In for Pricing
View Details
EVA1A Human Pre-designed siRNA Set A
HY-RS04571 1 Set

EVA1A Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Phospholipase C beta 2 (PLCB2) (NM_001284299) Human Untagged Clone
SC334408 10 µg

Phospholipase C beta 2 (PLCB2) (NM_001284299) Human Untagged Clone

Sign In for Pricing
View Details
FCRL2 Goat Polyclonal Antibody
TA348947 100 µg

FCRL2 Goat Polyclonal Antibody

Sign In for Pricing
View Details
Polyclonal Antibody to Leukocyte Cell Derived Chemotaxin 2 (LECT2)
MBS2139745-01 0.1 mL

Polyclonal Antibody to Leukocyte Cell Derived Chemotaxin 2 (LECT2)

Sign In for Pricing
View Details
Polyclonal Antibody to Leukocyte Cell Derived Chemotaxin 2 (LECT2)
MBS2139745-02 0.2 mL

Polyclonal Antibody to Leukocyte Cell Derived Chemotaxin 2 (LECT2)

Sign In for Pricing
View Details