Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-3 alpha/CCL20, Mouse

MIP-3 alpha/CCL20 Protein, Mouse is a CC chemokine that attracts lymphocytes and mild neutrophils by binding to and acting on the chemokine receptor CCR6. It induces intracellular calcium mobilization and mediates cancer, various autoimmune diseases, and antimicrobial effects. MIP-3 alpha/CCL20 Protein, Mouse is a recombinant mouse CCL20 (A28-M97) expressed by E. coli[1].

Product Specifications

Product Name Alternative

MIP-3 alpha/CCL20 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mip-3-alpha-ccl20-protein-mouse.html

Purity

97.00

Smiles

ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Molecular Formula

20297 (Gene_ID) O89093 (A28-M97) (Accession)

Molecular Weight

Approximately 8-9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Skovdahl HK, et al. C-C Motif Ligand 20 (CCL20) and C-C Motif Chemokine Receptor 6 (CCR6) in Human Peripheral Blood Mononuclear Cells: Dysregulated in Ulcerative Colitis and a Potential Role for CCL20 in IL-1β Release. Int J Mol Sci. 2018 Oct 20;19 (10) .|[2]Benkheil M, et al. CCL20, a direct-acting pro-angiogenic chemokine induced by hepatitis C virus (HCV) : Potential role in HCV-related liver cancer. Exp Cell Res. 2018 Nov 15;372 (2) :168-177.|[3]Louis Boafo Kwantwi, et al. Multifaceted roles of CCL20 (C-C motif chemokine ligand 20) : mechanisms and communication networks in breast cancer progression. Bioengineered. 2021 Dec;12 (1) :6923-6934.|[4]M Baba, et al. Identification of CCR6, the specific receptor for a novel lymphocyte-directed CC chemokine LARC. J Biol Chem. 1997 Jun 6;272 (23) :14893-8.|[5]Gisela Soboll, et al. Effect of oestradiol on PAMP-mediated CCL20/MIP-3 alpha production by mouse uterine epithelial cells in culture. Immunology. 2006 Jun;118 (2) :185-94.|[6]Jinlin Liu, et al. Tumor-associated macrophages recruit CCR6+ regulatory T cells and promote the development of colorectal cancer via enhancing CCL20 production in mice. PLoS One. 2011 Apr 29;6 (4) :e19495.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIN1 Polyclonal Antibody
E-AB-90675-01 60 µL

RIN1 Polyclonal Antibody

Sign In for Pricing
View Details
RIN1 Polyclonal Antibody
E-AB-90675-02 120 µL

RIN1 Polyclonal Antibody

Sign In for Pricing
View Details
RIN1 Polyclonal Antibody
E-AB-90675-03 200 µL

RIN1 Polyclonal Antibody

Sign In for Pricing
View Details
Prolyl Endopeptidase (PREP) (NM_002726) Human Over-expression Lysate
LY400960 100 µg

Prolyl Endopeptidase (PREP) (NM_002726) Human Over-expression Lysate

Sign In for Pricing
View Details
BCNP (FAM129C) Rabbit Polyclonal Antibody
TA372099 100 µL

BCNP (FAM129C) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Stomach
CR559737 5 µg

Tissue Total RNA, Stomach

Sign In for Pricing
View Details