Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-2-glycoprotein 1 (APOH)

Product Specifications

Product Name Alternative

APC inhibitor; Activated protein C-binding protein; Anticardiolipin cofactor; Apolipoprotein H; Beta-2-glycoprotein I

Abbreviation

Recombinant Human APOH protein

Gene Name

APOH

UniProt

P02749

Expression Region

20-345aa

Organism

Homo sapiens (Human)

Target Sequence

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cardiovascular

Relevance

Binds to various kinds of negatively charged substances such as heparin, phospholipids, and dextran sulfate. May prevent activation of the intrinsic blood coagulation cascade by binding to phospholipids on the surface of damaged cells

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TentaGel® S PAL
S30022.25G 25 g

TentaGel® S PAL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF405S conjugate, 0.1mg/mL
BNC041917-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Acin1 activation kit by CRISPRa
GA205865 1 Kit

Mouse Acin1 activation kit by CRISPRa

Sign In for Pricing
View Details
p38 (MAPK14) pThr180 Rabbit Polyclonal Antibody
AP02504PU-N 100 µL

p38 (MAPK14) pThr180 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human LILRB4/CD85k/ILT3 Protein (aa 22-259, Fc Tag)
PKSH033604-01 10 µg

Recombinant Human LILRB4/CD85k/ILT3 Protein (aa 22-259, Fc Tag)

Sign In for Pricing
View Details
Recombinant Human LILRB4/CD85k/ILT3 Protein (aa 22-259, Fc Tag)
PKSH033604-02 50 µg

Recombinant Human LILRB4/CD85k/ILT3 Protein (aa 22-259, Fc Tag)

Sign In for Pricing
View Details