Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pestis DNA-binding protein

Product Specifications

Abbreviation

Recombinant Yersinia pestis DNA-binding protein

UniProt

O68768

Expression Region

1-187aa

Organism

Yersinia pestis

Target Sequence

MALYNFTLTLSGVTYETEGLEDALYESGCGDAIVCAYGNSVYVEFDREAKSLDAAIASAVDNIESAGIGAIVESVDSALVGLSDVAEMTGMSRQAITMLKDGLRGGGDFPCPIQRIQGQSPLWDWADVANWLEANGRLKENAELAHNARVLSKWNLALRNSVSKDFVEIEHIASSLIARRRHHAECA

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUSP8 sgRNA CRISPR Lentivector (Human) (Target 3)
K0638604 1.0 µg DNA

DUSP8 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit Anti-GCP3 antibody
SL13277R-01 50 µL

Rabbit Anti-GCP3 antibody

Sign In for Pricing
View Details
Rabbit Anti-GCP3 antibody
SL13277R-02 100 µL

Rabbit Anti-GCP3 antibody

Sign In for Pricing
View Details
TP53, Phosphorylated (S15) (Tumor Protein p53, P53, BCC7, LFS1, TRP53) (HRP)
MBS6441306-01 0.1 mL

TP53, Phosphorylated (S15) (Tumor Protein p53, P53, BCC7, LFS1, TRP53) (HRP)

Sign In for Pricing
View Details
TP53, Phosphorylated (S15) (Tumor Protein p53, P53, BCC7, LFS1, TRP53) (HRP)
MBS6441306-02 5x 0.1 mL

TP53, Phosphorylated (S15) (Tumor Protein p53, P53, BCC7, LFS1, TRP53) (HRP)

Sign In for Pricing
View Details
4930568D16Rik Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
10685064 1.0 µg DNA

4930568D16Rik Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details