Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC), partial

Product Specifications

Product Name Alternative

Pre-GP-C; GPC; GP-C

Abbreviation

Recombinant Lassa virus GPC protein, partial

Gene Name

GPC

UniProt

P08669

Expression Region

59-259aa

Organism

Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV)

Target Sequence

TSLYKGVYELQTLELNMETLNMTMPLSCTKNNSHHYIMVGNETGLELTLTNTSIINHKFCNLSDAHKKNLYDHALMSIISTFHLSIPNFNQYEAMSCDFNGGKISVQYNLSHSYAGDAANHCGTVANGVLQTFMRMAWGGSYIALDSGRGNWDCIMTSYQYLIIQNTTWEDHCQFSRPSPIGYLGLLSQRTRDIYISRRLL

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

Functions as a cleaved signal peptide that is retained as the third component of the GP complex (GP-C) . Helps to stabilize the spike complex in its native conformation. The SSP is required for efficient glycoprotein expression, post-translational maturation cleavage of G1 and G2, glycoprotein transport to the cell surface plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKR1E2 sgRNA CRISPR Lentivector (Human) (Target 3)
K2746004 1.0 µg DNA

AKR1E2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Opn3 ORF Vector (Mouse) (pORF)
34849014 1.0 µg DNA

Opn3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
GDF6, CT (Growth/Differentiation Factor 6, GDF-6, Growth/Differentiation Factor 16, GDF16)
MBS625397-01 0.2 mL

GDF6, CT (Growth/Differentiation Factor 6, GDF-6, Growth/Differentiation Factor 16, GDF16)

Sign In for Pricing
View Details
GDF6, CT (Growth/Differentiation Factor 6, GDF-6, Growth/Differentiation Factor 16, GDF16)
MBS625397-02 5x 0.2 mL

GDF6, CT (Growth/Differentiation Factor 6, GDF-6, Growth/Differentiation Factor 16, GDF16)

Sign In for Pricing
View Details
Fam13b sgRNA CRISPR Lentivector (Rat) (Target 3)
K7563904 1.0 µg DNA

Fam13b sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Recombinant Danio rerio Protein MMS22-like (mms22l), partial
MBS1063087 Inquire

Recombinant Danio rerio Protein MMS22-like (mms22l), partial

Sign In for Pricing
View Details