Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galectin-3 (LGALS3)

Product Specifications

Product Name Alternative

35 kDa lectin; Carbohydrate-binding protein 35; Galactose-specific lectin 3; Galactoside-binding protein; IgE-binding protein; L-31; Laminin-binding protein; Lectin L-29; Mac-2 antigen

Abbreviation

Recombinant Human LGALS3 protein

Gene Name

LGALS3

UniProt

P17931

Expression Region

1-250aa

Organism

Homo sapiens (Human)

Target Sequence

MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Metabolism

Relevance

Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis. In the nucleus: acts as a pre-mRNA splicing factor. Involved in acute inflammatory responses including neutrophil activation and adhesion, chemoattraction of monocytes macrophages, opsonization of apoptotic neutrophils, and activation of mast cells. Together with TRIM16, coordinates the recognition of membrane damage with mobilization of the core autophagy regulators ATG16L1 and BECN1 in response to damaged endomembranes

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APG5L (Y35) (Autophagy protein 5, APG5-like, Apoptosis-specific protein, ATG5, APG5L, ASP, ) (PE) discontinued
031966-PE 200 µL

APG5L (Y35) (Autophagy protein 5, APG5-like, Apoptosis-specific protein, ATG5, APG5L, ASP, ) (PE) discontinued

Sign In for Pricing
View Details
LDB3 Rabbit pAb
E47R20175 100 µL

LDB3 Rabbit pAb

Sign In for Pricing
View Details
Tube Holder, Foam, for use w GVM Series
GVM-AS-ADAPT8-16 1 Each

Tube Holder, Foam, for use w GVM Series

Sign In for Pricing
View Details
Recombinant Human RALY Protein
E30P60263A 50 µg

Recombinant Human RALY Protein

Sign In for Pricing
View Details
Rabbit Anti-Human MAPT Polyclonal Antibody, Phospho-Thr181
CPB-669RH 100 ul

Rabbit Anti-Human MAPT Polyclonal Antibody, Phospho-Thr181

Sign In for Pricing
View Details
CIAPIN1 sgRNA CRISPR Lentivector (Human) (Target 1)
K0452502 1.0 µg DNA

CIAPIN1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details