Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-12 subunit beta (IL12B)

Product Specifications

Product Name Alternative

Cytotoxic lymphocyte maturation factor 40 kDa subunit; IL-12 subunit p40; NK cell stimulatory factor chain 2

Abbreviation

Recombinant Human IL12B protein

Gene Name

IL12B

UniProt

P29460

Expression Region

23-328aa

Organism

Homo sapiens (Human)

Target Sequence

IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINB6 Polyclonal Antibody
ANT-14347-50ug 50 µg

SERPINB6 Polyclonal Antibody

Sign In for Pricing
View Details
Plakophilin 2/PKP2 Rabbit Polyclonal Antibody (HRP)
orb2589547 100 µg

Plakophilin 2/PKP2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Rabbit Anti-Mouse Chemokine (C-X-C Motif) Ligand 7 (CXCL7) Polyclonal Antibody
VD1N448 1 Each

Rabbit Anti-Mouse Chemokine (C-X-C Motif) Ligand 7 (CXCL7) Polyclonal Antibody

Sign In for Pricing
View Details
Zfp708 Protein Vector (Mouse) (pPM-C-HA)
PV250096 500 ng

Zfp708 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)
MBS2119242-01 0.1 mL

APC-Linked Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)
MBS2119242-02 0.2 mL

APC-Linked Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)

Sign In for Pricing
View Details