Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Killer cell immunoglobulin-like receptor 2DL3 (KIR2DL3), partial

Product Specifications

Product Name Alternative

CD158 antigen-like family member B2; KIR-023GB; Killer inhibitory receptor cl 2-3; NKAT2a; NKAT2b; Natural killer-associated transcript 2; p58 natural killer cell receptor clone CL-6; p58.2 MHC class-I-specific NK receptor

Abbreviation

Recombinant Human KIR2DL3 protein, partial

Gene Name

KIR2DL3

UniProt

P43628

Expression Region

22-245aa

Organism

Homo sapiens (Human)

Target Sequence

HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Receptor on natural killer (NK) cells for HLA-C alleles (HLA-Cw1, HLA-Cw3 and HLA-Cw7) . Inhibits the activity of NK cells thus preventing cell lysis

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Butyldeoxynojirimycin Hydrochloride
TRC-B691000-25MG 25 mg

N-Butyldeoxynojirimycin Hydrochloride

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), CF405S conjugate, 0.1mg/mL
BNC041865-500 1x 500 µL

Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/3149R), CF405S conjugate, 0.1mg/mL
BNC043149-500 1x 500 µL

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/3149R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EIF4EBP1 pThr37 Rabbit Polyclonal Antibody
AP20834PU-N 100 µg

EIF4EBP1 pThr37 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Boll Mouse Gene Knockout Kit (CRISPR)
KN502224 1 Kit

Boll Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Spleen
CR560454 5 µg

Tissue Total RNA, Spleen

Sign In for Pricing
View Details