Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth-regulated alpha protein (CXCL1)

Product Specifications

Product Name Alternative

C-X-C motif chemokine 1; GRO-alpha (1-73) ; Melanoma growth stimulatory activity; Neutrophil-activating protein 3

Abbreviation

Recombinant Human CXCL1 protein

Gene Name

CXCL1

UniProt

P09341

Expression Region

35-107aa

Organism

Homo sapiens (Human)

Target Sequence

ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha (4-73), GRO-alpha (5-73) and GRO-alpha (6-73) show a 30-fold higher chemotactic activity

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

9.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A1874 25mg
A18735-25 25 mg

A1874 25mg

Sign In for Pricing
View Details
Anti-SLFN2/SLFN3/SLFN4(schlafen 2/schlafen 3/schlafen 4)
Y050768 100 µg

Anti-SLFN2/SLFN3/SLFN4(schlafen 2/schlafen 3/schlafen 4)

Sign In for Pricing
View Details
DL-Phenylalanine t-butyl ester hydrochloride
sc-294406A 25 g

DL-Phenylalanine t-butyl ester hydrochloride

Sign In for Pricing
View Details
MYOZ3 Human shRNA Plasmid Kit (Locus ID 91977)
TL303063 1 Kit

MYOZ3 Human shRNA Plasmid Kit (Locus ID 91977)

Sign In for Pricing
View Details
Tiger17 TFA
orb1980059-01 1 mg

Tiger17 TFA

Sign In for Pricing
View Details
Tiger17 TFA
orb1980059-02 5 mg

Tiger17 TFA

Sign In for Pricing
View Details