Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glypican-3 (GPC3), partial

Product Specifications

Product Name Alternative

GTR2-2; Intestinal protein OCI-5; MXR7

Abbreviation

Recombinant Human GPC3 protein, partial

Gene Name

GPC3

UniProt

P51654

Expression Region

25-358aa

Organism

Homo sapiens (Human)

Target Sequence

QPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVMQGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYR

Tag

C-terminal 10xHis-HSA-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Cell surface proteoglycan. Negatively regulates the hedgehog signaling pathway when attached via the GPI-anchor to the cell surface by competing with the hedgehog receptor PTC1 for binding to hedgehog proteins. Binding to the hedgehog protein SHH triggers internalization of the complex by endocytosis and its subsequent lysosomal degradation. Positively regulates the canonical Wnt signaling pathway by binding to the Wnt receptor Frizzled and stimulating the binding of the Frizzled receptor to Wnt ligands. Positively regulates the non-canonical Wnt signaling pathway. Binds to CD81 which decreases the availability of free CD81 for binding to the transcriptional repressor HHEX, resulting in nuclear translocation of HHEX and transcriptional repression. Inhibits the dipeptidyl peptidase activity of DPP4. Plays a role in limb patterning and skeletal development by controlling the cellular response to BMP4. Modulates the effects of growth factors BMP2, BMP7 and FGF7 on renal branching morphogenesis. Required for coronary vascular development. Plays a role in regulating cell movements during gastrulation

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

107.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-p21 Cip1 (Thr145) Antibody
MBS8511473-01 0.05 mg

Phospho-p21 Cip1 (Thr145) Antibody

Sign In for Pricing
View Details
Phospho-p21 Cip1 (Thr145) Antibody
MBS8511473-02 0.1 mg

Phospho-p21 Cip1 (Thr145) Antibody

Sign In for Pricing
View Details
Phospho-p21 Cip1 (Thr145) Antibody
MBS8511473-03 0.1 mL (AF750)

Phospho-p21 Cip1 (Thr145) Antibody

Sign In for Pricing
View Details
Phospho-p21 Cip1 (Thr145) Antibody
MBS8511473-04 0.1 mL (AF405M)

Phospho-p21 Cip1 (Thr145) Antibody

Sign In for Pricing
View Details
Phospho-p21 Cip1 (Thr145) Antibody
MBS8511473-05 0.1 mL (AF546)

Phospho-p21 Cip1 (Thr145) Antibody

Sign In for Pricing
View Details
Phospho-p21 Cip1 (Thr145) Antibody
MBS8511473-06 0.1 mL (AF405L)

Phospho-p21 Cip1 (Thr145) Antibody

Sign In for Pricing
View Details